Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6S1 Olfactory Receptor

Gene Symbol OR6S1
Organism Dog
Family 6
Subfamily S
Pseudo No
Location chr15:17934184-17935176 (-)
Aliases cOR6S2, cOR6S2

Sequence information


Nucleotide sequence

ATGGCTCCTGGCGAGAACCAGAGCAGCGGTGTGACCGAGTTCATCTTGGCAGGCTTCCCA
AATCTCAACAACACAAAAGCAGAAGTGTTCTCTGTCTTCCTTCTTGTCTACCTGCTGACT
CTAACAGGCAACGTGCTGATTGTTGGGGTGGTGGGAGCGGATGCTCGCCTGCAGACCCCC
ATGTACTTCTTCCTGGGCAACCTGTCCTGCCTCGAGATCTTGCTCACTTCCGTCATCATT
CCCAAGATGCTGAGCAATTTCCTTTCCAGGCAACACACCATCTCCTTTGCTGCATGCATT
ACTCAATTCTATTTCTACTTCTTTCTTGGGGCCTCTGAGTTCCTGCTGTTGGCCGTCATG
TCTGTGGATCGCTACCTGGCCATCTGTCACCCTCTGCACTATCCCTTGCTCATGAATGGT
GCTGTGTGCTCTCGGGTGGCCTTGGCCTGCTGGATGGGGGGACTTGTCCCTGTGCTTGGC
CCCACGGTGGCTGTGGCCTTACTTCCCTTCTGTGAACAGCACACTGTGGTGCAGCATTTC
TTCTGTGACAGTGGCCCTCTGCTCCGCCTGGCATGCACCAACACCAAGAAGCTGGAGGAA
ACAGACTTCGTGCTGGCCTCTCTGGTCATCATATCCTCGCTGATGATTACTGCTGTGTCC
TATGGCCACATAGCTCTGGCTGTCCTGCGCATTCCCTCTGTTTCCGGCCGTCAGAAGGCC
TTCTCTACCTGTACCTCTCACTTGATGGTGGTGACCCTCTTCTATGGAAGTGCCATTTTT
CTCTATGTGCGACCATCACAGAGTGGCTCTGTGAATACCAACTGGGCAGTGACAGTGGTA
ACAACGTTTGTGACACCGCTGCTGAATCCATTCATCTATGCCTTACGCAATGAGCGAGTC
AAGGAAGCTTTGAAGGATATGTTCAGGAAGATGGGAGTAGGCTTTTGGGGGAATCTTCTA
CTCACTAAGAATTTCAGTAAGAAGACAGTGAAG


Conceptual translation

MAPGENQSSGVTEFILAGFPNLNNTKAEVFSVFLLVYLLTLTGNVLIVGVVGADARLQTP
MYFFLGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVM
SVDRYLAICHPLHYPLLMNGAVCSRVALACWMGGLVPVLGPTVAVALLPFCEQHTVVQHF
FCDSGPLLRLACTNTKKLEETDFVLASLVIISSLMITAVSYGHIALAVLRIPSVSGRQKA
FSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVNTNWAVTVVTTFVTPLLNPFIYALRNERV
KEALKDMFRKMGVGFWGNLLLTKNFSKKTVK