Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7E24 Olfactory Receptor

Gene Symbol OR7E24
Organism Dog
Family 7
Subfamily E
Pseudo No
Location chr20:51395297-51396286 (+)
Aliases cOR7E152, cOR7E152

Sequence information


Nucleotide sequence

ATGCTCATTTACTTGTTTCACTTTTCCAACCCTCTTTTCTTTTTTAAAAGGTGTCCAAGC
TACATAGAACCACAAAATCTAACAAGTGTATCAGAGTTCTTCCTCATGGGCCTCTCAGAT
GATCCAGAACTGCAGCCCCTCCTCTTTGGGCTGTTCCTGTCCATGTACCTGGTCACTGTG
CTTGGGAATCTGCTCATCATCTTGGCCGTCAGCTCTGACTCCCACCTCCACATCCCCATG
TACTTCCTCCTCTCCAACCTGTCCTTGGCTGACATTGGTTTCACCTCCACCACAGTCCCC
AAGATGATCATGGACATCCAAACTCAGAGCAGAGTCATCTCCTATGTGGGTTGCCTGACT
CAAATGTCTTTTTTTATGCTTTTTGGATGTTTGGATAGTCTCCTCCTGGCTGTGATGGCG
TATGACCGGTTTGTGGCCATCTGTCACCCCCTGCACTACTTGATCATCATGAACCCCCGC
CTCTGTGGCTTGTTGGTTTTGGCGTCATTTTTAATCAGCCTGTTGGTCTCCCAGATGCAC
AATTCAATTGTGTTACAACTTACTTACTTCAAGGATGTGGAAATTTCTCATTTCTTCTGT
GATCCTTCTCAACTCCTCAACCTTGCCTGTTCTGACACTTTTATCAATAACATAGTCATG
TATTTTGTTGGTGCCATCTCTGGCTTTCTTCCTATTTCAGGGATCTTTTTCTCTTACTAT
AAAATTGTTTCCTCCATTCTGAGAGTCCCATCCACAGGTGGGAGATACAAAGCCTTCTCC
ACCTGTGGCTCCCACCTGTCAGTTGTTTGCTTATTTTATGGAACAGGCCTTGGGGTGTAC
CTTAGTTCAGCTGTCTCACTTTCTCCCAGGAAGGATGCAGTGGCCTCAGTGGTGTATACT
GTGGTCACCCCCATGCTGAACCCTTTCATCTACAGCCTGAGGAACAGGGACATCAAAAGG
GCCATGTGGAGGCTCTTCAGTAAAACAATC


Conceptual translation

MLIYLFHFSNPLFFFKRCPSYIEPQNLTSVSEFFLMGLSDDPELQPLLFGLFLSMYLVTV
LGNLLIILAVSSDSHLHIPMYFLLSNLSLADIGFTSTTVPKMIMDIQTQSRVISYVGCLT
QMSFFMLFGCLDSLLLAVMAYDRFVAICHPLHYLIIMNPRLCGLLVLASFLISLLVSQMH
NSIVLQLTYFKDVEISHFFCDPSQLLNLACSDTFINNIVMYFVGAISGFLPISGIFFSYY
KIVSSILRVPSTGGRYKAFSTCGSHLSVVCLFYGTGLGVYLSSAVSLSPRKDAVASVVYT
VVTPMLNPFIYSLRNRDIKRAMWRLFSKTI