Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7G3 Olfactory Receptor

Gene Symbol OR7G3
Organism Dog
Family 7
Subfamily G
Pseudo No
Location chr20:51576528-51577532 (+)
Aliases cOR7G12, cOR7G12

Sequence information


Nucleotide sequence

ATGTTTAAGAAAGTTTCTCTTGTTTTGTTTTCTTGTCACCTCTATCTTTTCTATCAGACC
CTCAGCAACATGACATCAGGAAACCTCTCAGATCCTACAGAATTCCTCCTCCTGGGACTG
TCAGAGGATCCAGAACTGCAGCCCCTTCTATTTTTCCTGTTCCTGTCTATGTACCTGGTG
TCAGTGCTTGGGAACCTGCTCATCATCCTGGCCATTCTGTATGACTTCCACCTCCACACT
CCCATGTACTTCTTCCTCTCCAATTTGTCTTTTGTTGACATCTGTTTCACCACCACAACA
ATCCCAAAGATGCTTGTAAACATCCGGACACACAGCAAATCCATCACTTACACAGGCTGC
CTCACACAAATCTGCTTTGTCCTGACTTTTGCTGGATTAGAAAATGGAATACTGGTAATG
ATGGCCTTTGATCGATTTGTGGCCATCTGTCACCCATTGAGGTACAATGTCATCATGAAT
CCCAAACTCTGTAGGCTGCTGGTTCTACTGTCCTTCCTTATTAGTGTTTTGGATGCCCTT
CTCCACACTTTGATGGCGTTGCGGCTGTCCTTCTGCACAGACCTGGAAATTCCCCACTTT
TTCTGTGAATTAGCTCATATTCTCAAGCTTGCCTGTTCCGATATCCTCATCAATAATATT
CTTGTGTATTTAGTGACCAGCTTGTTGGGTGTTATTCCTCTCTCTGGGATAATTATCTCT
TACACTCAAATTGTTTCCTCTGTCCTGAAAATCCCATCAGCTGGTGGAAAGTATAAGGCA
TTTTCCATCTGTGGGTCACACTTAATAGTTGTTTCTTTGTTCTATGGGACAGGTTTTAGG
GTGTACCTTAGTTCCGCAGCTACACACTCCTCCAGGAAGAGCGCAATAGTATCAGTGATG
TACACTGTGGTCACCCCCATGATGAATCCCTTTATCTATAGTCTGAGAAACAAGGATATG
ATGGGGGCTTTGAGGAAATTGATTTCTAGAATATCATATTTCCAT


Conceptual translation

MFKKVSLVLFSCHLYLFYQTLSNMTSGNLSDPTEFLLLGLSEDPELQPLLFFLFLSMYLV
SVLGNLLIILAILYDFHLHTPMYFFLSNLSFVDICFTTTTIPKMLVNIRTHSKSITYTGC
LTQICFVLTFAGLENGILVMMAFDRFVAICHPLRYNVIMNPKLCRLLVLLSFLISVLDAL
LHTLMALRLSFCTDLEIPHFFCELAHILKLACSDILINNILVYLVTSLLGVIPLSGIIIS
YTQIVSSVLKIPSAGGKYKAFSICGSHLIVVSLFYGTGFRVYLSSAATHSSRKSAIVSVM
YTVVTPMMNPFIYSLRNKDMMGALRKLISRISYFH