Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8B3 Olfactory Receptor

Gene Symbol OR8B3
Organism Dog
Family 8
Subfamily B
Pseudo No
Location chr5:9992796-9993818 (+)
Aliases cOR8B3, cOR8B3

Sequence information


Nucleotide sequence

ATGACAGCGTGTAAGGAGGGAGCTGGGTTTTCTATTAATGGGATTTTCTTCTGTTCTCAC
AGATTTCCAAAGAGGAGAATATTGGTTAGAAATGACTCCTTAGTGACTGAATTCCTTCTT
GCTGGATTAACAGACCGCCCTGAGCTCCAGCAACCTCTCTTCTTCCTGTTTCTGATGATC
TACATCGTCACCATGGTGGGCAACCTTGGCTTGATCATCCTCATCGGTCTCAATTCTCAC
CTCCACACCCCCATGTACTATTTCCTCTTCAATCTATCCTTCATTGATCTCTGTTACTCT
TCTGTTTTTACCCCCAAGATGCTGATGAACTTTGTATCAAAGGACAATATCATCTCCTAT
GTTGGGTGCATGACTCAACTGTTCTTCTTTCTCTTTTTTGTCATCTCAGAATGCTACATG
TTGACCTCAATGGCCTATGACCGCTATGTGGCCATCTGTAATCCATTGTTGTATAAGGTC
ACCATGTCCCATCAGGTCTGTTCCTTGCTAACTGTTGCTGCATATATGATGGGATTTGCC
AGAGCCTCTGCCCACACGGGGTGCATGCTTAGACTAACGTTCTGCAATGTCAATATCATC
AACCATTACCTGTGTGACATCCTTCCTCTCCTCCAACTCTCTTGCACCAGCACCTATGTC
AATGAGGTAGTAGTTCTGATAGTCGTGGGAATTAATATCACAGTACCCAGTTTTACCATC
CTGATTTCTTACGTCTTCATCCTCACTAGCATTCTTCATATCAAATCTGCTCAAGGAAGA
TCAAAAGCCTTCAGTACTTGTAGCTCTCACGTCATTGCTCTGTGTCTTTTTTTTGGATCA
GCAGCATTCATGTATCTTAAATATTCTTCTCCTGGATCTATGGAGCAGGGAAAAATTTCT
TCAGTGTTCTATACTAATGTGGGACCCATGCTCAATCCCCTGATCTACAGTTTGAGGAAT
AAGGATGTCAAAATTGCACTGCGGAAAGCTCTGATTAGAATATGGAAGAGAAACATTAGA
TTC


Conceptual translation

MTACKEGAGFSINGIFFCSHRFPKRRILVRNDSLVTEFLLAGLTDRPELQQPLFFLFLMI
YIVTMVGNLGLIILIGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMNFVSKDNIISY
VGCMTQLFFFLFFVISECYMLTSMAYDRYVAICNPLLYKVTMSHQVCSLLTVAAYMMGFA
RASAHTGCMLRLTFCNVNIINHYLCDILPLLQLSCTSTYVNEVVVLIVVGINITVPSFTI
LISYVFILTSILHIKSAQGRSKAFSTCSSHVIALCLFFGSAAFMYLKYSSPGSMEQGKIS
SVFYTNVGPMLNPLIYSLRNKDVKIALRKALIRIWKRNIRF