Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8U8 Olfactory Receptor

Gene Symbol OR8U8
Organism Dog
Family 8
Subfamily U
Pseudo No
Location chr18:39534872-39535831 (-)
Aliases cOR8U3, cOR8U3, cOR8U7

Sequence information


Nucleotide sequence

ATGCCTTTAAGAGATATGGCTCAGATAAATTGTACCCACGTACAGGAGTTTATTCTCATG
GGCCTCACAGATCGAAAGGAGTTGAAGATGCCCTTCTTTGTGGTTTTCTTGTCTATCTAC
TTCTTGACAGTAGTAGGCAATCTAGGTTTGATCCTAGTCATTAGAACAGATTCAAGACTT
ACTAACACACCGATGTACTTCTTTCTTAGCAACCTAGCTTTTGTTGATTTCTGTTATGCT
TCTGTCATTACACCCAAAATGCTTGGCAATTTCTTGTACAAACAAAATGTTATCTCCTTC
AATGCATGTGCTGCTCAGTTAGGCTGTTTCCTCACTTTCATGGTATCTGAGTGCTTGCTA
CTGGCATCCATGGCCTATGACCGATACGTGGCCATTTGTAACCCTCTCCTCTACATGGTT
GTAATGTCCCCAGGAATCCGCATTCAGCTTGTAGCTGTTCCCTACAGCTATAGCTTTCTT
ATGGCACTATTTCATACCATCCTCACTTTTCGCCTCTCCTATTGTCATTCCAATATCATC
AATCATTTCTATTGTGATGACATGCCTCTCCTTAGGCTAACCTGTTCAGACACTCACTCC
AAACAGCTGTGGATCTTGGCCTGTGCTGGGATCACATTCATTTCCTCTGTTCTGATTGTC
TTCGTCTCCTATATGTACATTATTTCTGCCATCCTGAGGATGCGCTCAGCTGAGGGCAGG
CGCAAGGCTTTCTCCACATGTGGCTCTCACATGCTGGCAGTCACCATCTTCTATGGGACC
CTCATCTTTATGTACTTACAGCCGAGCTCAAACCATTCCCTAGACACAGACAAAATGGCC
TCAGTCTTCTACACAGTGATCATTCCCATGTTGAACCCCTTGATCTACAGCCTCAGGAAT
AAAGATGTAAAAGATGCCCTGAAAAAAGCCATCCTTAATAGAAACCAAGCTTTGTGTTTA


Conceptual translation

MPLRDMAQINCTHVQEFILMGLTDRKELKMPFFVVFLSIYFLTVVGNLGLILVIRTDSRL
TNTPMYFFLSNLAFVDFCYASVITPKMLGNFLYKQNVISFNACAAQLGCFLTFMVSECLL
LASMAYDRYVAICNPLLYMVVMSPGIRIQLVAVPYSYSFLMALFHTILTFRLSYCHSNII
NHFYCDDMPLLRLTCSDTHSKQLWILACAGITFISSVLIVFVSYMYIISAILRMRSAEGR
RKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRN
KDVKDALKKAILNRNQALCL