Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8U9 Olfactory Receptor

Gene Symbol OR8U9
Organism Dog
Family 8
Subfamily U
Pseudo No
Location chr18:39527366-39528322 (-)
Aliases cOR8U2, cOR8U2, cOR8U4P

Sequence information


Nucleotide sequence

ATGGTCCAGAGAAATTGCACCCAAGTGACAGAATTTATTCTCATGGGCCTCACAGATCGT
CAGGAGTTGAAGATGCCCCTCTTTGTGGCTTTCTTATCTATCTACCTCTTCACAGTAGTA
GGTAACCTGGGTTTGATCCTAGTCATTAGAACAGACTCAAGACTCAACACACCAATGTAC
TTCTTTCTTAGCAACCTAGCTTTTGTTGATTTCTGTTATGCTTCTGTCATTACACCCAAA
ATGCTTGGCAATTTCTTGTACAAACAAAATGTTATCTCCTTCAATGCATGTGCTGCTCAA
TTAGGCTGTTTCCTGGCCTTCATGACTGCTGAGTGCTTGCTACTGGCATCCATGGCCTAT
GACCGATACGTGGCCATTTGTAACCCTCTCCTCTACATGGTTGTAATGTCCCCAGGAATC
TGCATTCAGCTTGTAGCTGTTCCCTACAGCTATAGCTTCCTGGTTGCACTATTTCATACC
ATCCTCACTTTTCGCCTCTCCTATTGTCATTCCAATATCATCAATCATTTCTATTGTGAT
GACATGCCTCTCCTTAGGCTAACCTGTTCAGACACTCACTCCAAACAGCTGTGGATCTTT
GCCTGTGCTGGGATCATGTTCATTTCTTCCCTTTTGATTGTCTTCGTCTCCTATACATAC
ATTATTTCTGCCATCCTGAGGATGCGCTCAGCCGAGGGCAGGCGCAAGGCTTTCTCCACA
TGTGGCTCTCACATGCTGGCAGTCACCATCTTCTATGGGACCCTCATCTTTATGTACTTA
CAGCCGAGCTCAAACCATTCCCTAGACACAGACAAAATGGCCTCAGTCTTCTACACAGTG
ATCATTCCCATGTTGAACCCTCTTATCTACAGCCTCAGGAATAAGGAGGTGAAAGATGCC
TTGAAGAAAGTTATCATCAGTAGAAACCAGGCTTTTATGTTCATGAAATTAAAGAAG


Conceptual translation

MVQRNCTQVTEFILMGLTDRQELKMPLFVAFLSIYLFTVVGNLGLILVIRTDSRLNTPMY
FFLSNLAFVDFCYASVITPKMLGNFLYKQNVISFNACAAQLGCFLAFMTAECLLLASMAY
DRYVAICNPLLYMVVMSPGICIQLVAVPYSYSFLVALFHTILTFRLSYCHSNIINHFYCD
DMPLLRLTCSDTHSKQLWIFACAGIMFISSLLIVFVSYTYIISAILRMRSAEGRRKAFST
CGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDA
LKKVIISRNQAFMFMKLKK