Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9A4 Olfactory Receptor

Gene Symbol OR9A4
Organism Dog
Family 9
Subfamily A
Pseudo No
Location chrUn_AAEX03022866:373-1314 (-)
Aliases cOR9A10, cOR9A10

Sequence information


Conceptual translation

MLGNQSSATEFYLLGFPGSKELHHLLFATFFFFYSVTLMGNMVIILIVCADKRLQSPMYF
FLGHLSALEILVTSVIVPVMLWGLLLPGMQTISLAACVTQLFLYLSLGTTEFALLGAMAV
DRYVAVCNPLRYNVIMNSRTCIWVVIVSWVFGFLFQIWPVYATFQLTFCKSNVVNNFFCD
RGQLLKLSCNNTLFIEFILFLMAVFVLFGSLIPTIISYTYIISTILKIPSASGRRKAFST
CASHFTCVVIGYGSCLFLYVKPKQTQAADYNRVVSLMVSVVTPFLNPFIFTLRNDKVIEA
LWDGMKRCCQLFNN