Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9I1 Olfactory Receptor

Gene Symbol OR9I1
Organism Dog
Family 9
Subfamily I
Pseudo No
Location chr18:38240309-38241250 (+)
Aliases cOR9I5, cOR9I5

Sequence information


Nucleotide sequence

ATGGCCAAGAATAATCTCACCACAGTAGCAGAGTTCATTCTCATGGGCTTTACGGACTAC
CACATGTGGGAGATTACCCTCTTCCTGATGTTTCTCATTTTCTATATTGTCACCCTTCTG
GGGAACGTGGGAATGATCATTCTGATCCAAGTGGATGTCCAACTCCACACCCCCATGTAC
TTCTTCCTGAGCCATCTCGCCCTGCTGGATGCCTGCTATGCCTCAGTGATCACCCCTCAG
ATCCTGGACACACTGGCCACAGGCAAAACAGTCATCTCCTTTGGCCAGTGTGCTACGCAG
TTCTTTTTCTTCACCATCTGTGCAGGCACAGAGTGTTTCCTGCTGGCAGTGATGGCCTAT
GACCGCTGTGTCGCTATTAGCAACCCACTGCTCTACACAGTGGTCATGAATCCCAGAATC
TGCTGGGGTTTGGTGGTTGGAGCCTACGTCTGTGGGGTGTCAGGAGCCATCCTGCGTACC
ACATGCACCTTCACCCTCTCCTTCTGTGACCACAATCAGATCAACTTCTTCTTCTGTGAT
GTCCCACCCCTGTTGAAGCTAGCCTGCAGTGACACAACAAACACGGAGATTGTCATTGTC
TTCTTTGGCAACTTTGTGATCTTGGCCAATGCCTTGGTCATTCTGATATCCTATCTGCTC
ATCATCAAGGCCATTCTGAAGGTGAAGTCTCCAGGTGGCAAGGTCAAGACTTTCTCCACA
TGTGCCTCCCACCTCACTGCTGTGACCCTTTTCTTTGGGACTCTCATCTTCATGTATCTG
CGGAGTAGCTCCAACAAGTCCCTGGAGGAAGACAAGGTCGTGTCTGTCTTCTACACTGTG
TTCATTCCCATGCTAAACCCTCTGATCTATAGCCTAAGAAACAAAGATGTGAAAGCAGCC
TTCAGAAAGGTCACTGGTAGATTCCAGGTGTCCCAGAGTGTG


Conceptual translation

MAKNNLTTVAEFILMGFTDYHMWEITLFLMFLIFYIVTLLGNVGMIILIQVDVQLHTPMY
FFLSHLALLDACYASVITPQILDTLATGKTVISFGQCATQFFFFTICAGTECFLLAVMAY
DRCVAISNPLLYTVVMNPRICWGLVVGAYVCGVSGAILRTTCTFTLSFCDHNQINFFFCD
VPPLLKLACSDTTNTEIVIVFFGNFVILANALVILISYLLIIKAILKVKSPGGKVKTFST
CASHLTAVTLFFGTLIFMYLRSSSNKSLEEDKVVSVFYTVFIPMLNPLIYSLRNKDVKAA
FRKVTGRFQVSQSV