Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Horse symbols

Horse OR4C3 Olfactory Receptor

Gene Symbol OR4C3
Organism Horse
Family 4
Subfamily C
Pseudo No
Location chrUn:44670799-44671704 (+)

Sequence information


Nucleotide sequence

ATGGAAATACCACACAAAATCACAGAATTTTTCATGCTAGGACTCTCACAGAACCCAGAC
GTACAGAGAGTTCTCTTTGTAGTCTTTTTGATCATCTATGTGGTCACAGTTTGTGGCAAC
ATGCTCATTGTGGTCACCATCACCTCCAGTCACACACTTGCTTCCCCCATGTATTTTTTT
CTGGGCAACTTGTCCTTTATTGACATCTGTTATTCTTCCTCTATGACCCCCAAACTCATT
GCTGACTCCTTGTATGAGGGGAGAGCCATCTCTTATGAAGGCTGCATGGCTCAGCTCTTT
GGAGCCCATTTTTTGGGAGGTGTTGAGATCATTCTGCTCACAGTGATGGCTTATGACCGC
TACATGGCCATCTGCAAGCCCCTGCACTACACTATCATCATGACGAGGCATCTCTGTGCC
CTGCTGGTGGGGGTGCCTTGGCTGGGGGGCTTCCTGCATTCATTGGTTCAGCTCCTCCTG
GTCCGTCAATTGCCCTTCTGTGGGCCCAACATGATCAACCACTTTGTCTGTGACTTGTAC
CCCTTGCTGGAACTCACCTGTACCAACACATATGTCATTGGTCTGCTGGTGGTCGCCAAC
AGTGGTGTGATCTGCCTGTTGAACTTCCTCATGCTGGCTGCCTCCTACATTGTCATCCTG
CACTCCTTGAGGTCCCACAGTGCAGAAGGGAGACGTAAAGCCCTCTCCACCTGTGGGGCC
CACTTCACTGTCGTTGCCTTGTTCTTTGTGCCCTGTGTATTTACTTACATACGTCCAACA
TCTACTTTATCTATAGACAAAAACATGGCAGTATTTTACGGTATTTTGACACCTATGTTG
AATCCACTCATTTATACCCTGAGAAACAAAGAGGTAAAAAATGCGATGAGAAAGCTTTTC
ACACAG


Conceptual translation

MEIPHKITEFFMLGLSQNPDVQRVLFVVFLIIYVVTVCGNMLIVVTITSSHTLASPMYFF
LGNLSFIDICYSSSMTPKLIADSLYEGRAISYEGCMAQLFGAHFLGGVEIILLTVMAYDR
YMAICKPLHYTIIMTRHLCALLVGVPWLGGFLHSLVQLLLVRQLPFCGPNMINHFVCDLY
PLLELTCTNTYVIGLLVVANSGVICLLNFLMLAASYIVILHSLRSHSAEGRRKALSTCGA
HFTVVALFFVPCVFTYIRPTSTLSIDKNMAVFYGILTPMLNPLIYTLRNKEVKNAMRKLF
TQ