Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Horse symbols

Horse OR5D15BP Olfactory Receptor

Gene Symbol OR5D15BP
Organism Horse
Family 5
Subfamily D
Pseudo Yes
Location chr12:13864632-13865573 (+)

Sequence information


Nucleotide sequence

AACAAAATTGTATTGAGTAATTCATTAATTTCTTGACACTCTCCTTCACATCTTTGTTCC
TGAGGCTATAGATCAGAGGATTCAGCATGGAAGTCACGACTGTATAAAACATAGAACCTA
ATTTGACTGTAAGCCATGAGTTTTTGGAATTGGGTACACAATAAAGGAACAGGATAGTCC
CATAGAAAATGGCAATTGCAGTCAGGTGGGAGGCACAAGTGGAGAGGCCTTTTTGGCATC
CACTAGCAGAAGGTATTTTTATGACAGTAACAAAAATGAATATATAAGTAGTGAGGAAGA
TTACTAGGCTGCTCGCCTCATTGAATATGGTGATGATAAAACAAAGCACTTGGCTGATGT
AAGGGTCAGAACAGGAGATAGAGACAATGGCTGAGTGGTCACAGAAAATATTATTTATTA
TGTTAGACCCACAAAAGGATAATGCCAGGAGAGAATATGTGAGTGTCAGAGAAGAGACTA
TACCCCATGTGTAGGGCCCAGCCACCAATGATGCACAGAGCTTTTGGGACATTACTACTG
TGTAGAGCAGAGGGTTGCAAACTGCCAAAAGTGGTCATAGGCCATCACTGCCAACATGAA
TGTTTCTGCCATCACAAATATACAAGCCAAGAAGAATTGTGTGATGCATCCTATGAAAGA
GATACTTCTGTCTTCCACAATCAAATTCTCCAACAGTTTGGGTATAACTGTAGTGGAATA
ACAAAAATCAACAAAGGACAAGTGGCAGAGAAAAAAATACATGGGGGTGTGGAGTTTAGG
ACTGATCCTGATGATCATGATCACGCCCAGGTTCCCCACCACAGTGACCATGTAGACGGT
CAAGAATACCAGGAACAGGGGTACCTGGAGGCCTGGATATTCTGAGAAGCCCAAGAGGGT
GAATGTGGTTCCAGCGCTCTGATTTCCTTCAGCTAGCAACAT


Conceptual translation

MLLAEGNQSAGTTFTLLGFSEYPGLQVPLFLVFLTVYMVTVVGNLGVIMIIRISPKLHTP
MYFFLCHLSFVDFCYSTTVIPKLLENLIVEDRSISFIGCITQFFLACIFVMAETFMLAVM
AYDH/LAVCNPLLYTVVMSQKLCASLVAGPYTWGIVSSLTLTYSLLALSFCGSNIINNI
FCDHSAIVSISCSDPYISQVLCFIITIFNEASSLVIFLTTYIFIFVTVIKIPSASGCQKG
LSTCASHLTAIAIFYGTILFLYCVPNSKNSWLTVKLGSMFYTVVTSMLNPLIYSLRNKDV
KESVKKLMNYSIQFC