Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10a4 Olfactory Receptor

Gene Symbol Or10a4
Organism Mouse
Family 10
Subfamily a
Pseudo No
Location chr7:107097449-107098411 (+)
Aliases Olfr17, MOR263-5, P2, MOR263-5, P2

Sequence information


Nucleotide sequence

ATGAAATCATGCAAAAGAATGACCTGGGGAAACTGGACAACTGTCAGGGAATTTATCCTC
ATGAGCTTCTCAAGCTTGTCCTATGAAGTACAGGCTCTGCTATTTCTCCTGTTTTTGATC
ATTTACCTAGTCACACTCATGGGCAATGTCCTCATCATCCTGGTTACTACAGCTGACTCT
GCTCTGCAAAGTCCTATGTACTTCTTCCTCAGAAACTTATCCTTCCTGGAAATAGGCTTC
AACTTGGTCATTGTGCCCAAGATGTTGAGTACTCTGATACTCCAGGACAAAACCATCTCC
TTCCTTGGCTGTGCTACTCAGATGTATTTCTTCTTTTTCTTTGGAGCTGCTGAGTGCTGC
CTCCTGGCCACAATGGCATATGACCGCTACATGGCGATCTGTGATCCCTTGCACTACCCA
ATAATCATGAGCCGAAGATCCTGTGCCCAGCTAGCAGCTGCCTCTTGGTTCTCCGGGTTC
CCAGTAGCCACTGTGCAAACCACATGGATTTTCAGTTTCCCTTTTTGTGGCCCAAACATG
GTGAACCACTTCTTCTGTGACAGCCCACCTGTCATAGCCCTAGTCTGTGCTGATACATCC
CTATTTGAACTGGAGGCTCTAACAGCCACTGTCCTATTCATCCTCTTTCCTTTCTTGTTG
ATTCTGGGTTCCTATGTCCGCATCCTCTCTACCATCTTTAGGATGCCTTCAGCTGAAGGG
AAACGCAAAGCCTTTTCCACTTGCTCCTCCCACCTCCTCGTTGTCTCCCTCTTCTACAGC
ACTGCCATCCTCACATACTTCCGGCCACGCTCAAACACCTCCCCTGAGAACAAGAAAATG
TTGTCACTCTCCTACACAGTTGTCACTCCCATGTTGAACCCCATCATCTACAGCTTAAGG
AATAATGAGGTGAAGGCTGCATTGAGGCGAATCATTCACAGAACTCTGGGCCCTCAGAAA
CTA


Conceptual translation

MKSCKRMTWGNWTTVREFILMSFSSLSYEVQALLFLLFLIIYLVTLMGNVLIILVTTADS
ALQSPMYFFLRNLSFLEIGFNLVIVPKMLSTLILQDKTISFLGCATQMYFFFFFGAAECC
LLATMAYDRYMAICDPLHYPIIMSRRSCAQLAAASWFSGFPVATVQTTWIFSFPFCGPNM
VNHFFCDSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYVRILSTIFRMPSAEG
KRKAFSTCSSHLLVVSLFYSTAILTYFRPRSNTSPENKKMLSLSYTVVTPMLNPIIYSLR
NNEVKAALRRIIHRTLGPQKL