Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10b1-ps Olfactory Receptor

Gene Symbol Or10b1-ps
Organism Mouse
Family 10
Subfamily b
Pseudo Yes
Location chr10:78,519,600-78,520,600 (+)
Aliases Olfr1358-ps1

Sequence information


Nucleotide sequence

QQDNGTWLVTEFLLVGFSNLPELRPTLFILFLLTYLVTLSGNATIITIIQVDRTLHTPMY
RFLAVLSLSETCYTLVTIPNMLAHLLMESQAISIAGCRAQMFFFLGLGCSHCFLLTLMGY
DRYVAICHPLRYSVIMRPTVCLCLGALVFCSGFSVALIETCMIFSSPFCGAGHVEHFFCD
IAPVLKLSCDESSLKGLGIFFLSILVVLVSFLFILLSYAFIVAAIVRIPSASGRRKAFST
CAAHLTVVIVHFGCASIIYLRPDSGANPSQDRLVAVFYTVVTPLLNPVVYTLRNKEVRVA
LRKNLARGCGAFK


Conceptual translation

QQDNGTWLVTEFLLVGFSNLPELRPTLFILFLLTYLVTLSGNATIITIIQVDRTLHTPMY
RFLAVLSLSETCYTLVTIPNMLAHLLMESQAISIAGCRAQMFFFLGLGCSHCFLLTLMGY
DRYVAICHPLRYSVIMRPTVCLCLGALVFCSGFSVALIETCMIFSSPFCGAGHVEHFFCD
IAPVLKLSCDESSLKGLGIFFLSILVVLVSFLFILLSYAFIVAAIVRIPSASGRRKAFST
CAAHLTVVIVHFGCASIIYLRPDSGANPSQDRLVAVFYTVVTPLLNPVVYTLRNKEVRVA
LRKNLARGCGAFK