Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10g7 Olfactory Receptor

Gene Symbol Or10g7
Organism Mouse
Family 10
Subfamily g
Pseudo No
Location chr9:39993812-39994744 (+)
Aliases Olfr978, MOR223-3, MOR223-3

Sequence information


Nucleotide sequence

ATGTCAAACACAAGCATAGTGACCACATTCTTCCTCTCAGGTCTTCCCCACCCACCAGTC
CTGGACTCCATGCTCTTTGGGATCTTCCTTGTGATTTATATTCTTACTGTGTTGGGAAAC
CTTCTCATCCTGACGGTGATCAGGGTGGATTCCCACCTCCACACACCAATGTACTACTTC
CTCACCAACCTCTCCTTTATTGACATGTGGTTCTCCACAGTCACAGTGCCTAAAATGCTG
ATGACTTTGGTGTCCACAGGGGGCGGGGCTATCTCCTTCCACAGCTGTGTGGCACAGCTC
TATTGCTTCCACTTCCTGGGTAGCACCGAGTGTTTCCTGTACACAGTCATGTCCTATGAT
CGCTACTTGGCCATCAGTTACCCACTCAGGTACAGCAGCATGATGGGTGGCAGAATGTGT
GCCCTCCTGGCAGCAGGAACATGGTTCACTGGTTCCCTGCACTCTGCTGTCCAGACTACA
TTGACCTTCCATTTGCCCTACTGTGGTCCCAACCAGATCCAGCATTATTTCTGTGATGCA
CCTCCCATCCTCAAGCTGGCCTGTGCAGACACCTCAGCCAATGAGATGGTCATCTTTGTG
AATATCGGGGTAGTGGCTTCGGGGTGTTTTTTTCTGATTTCGCTGTCCTATGTGTCCATT
GTCTGCTCCATCCTGAGGATTCGCACTTCAGAGGGCCGGCACAGAGCTTTCCAGACATGT
GCCTCACACTGCATCGTGGTCCTCTGTTTCTTTGGCCCTGGTCTCTTCATCTACCTGAGG
CCAGGCTCCAGGGATGCTGTAGATGGAATTGTGGCCGTTTTCTACACTGTGTTGACACCC
CTACTCAACCCTGTTGTGTACACCCTGAGGAACAAAGAAGTGAAGAAAGCACTGTTGAAA
ATAAAATATGGGTCTGTGCTTCCTCAGGATAAA


Conceptual translation

MSNTSIVTTFFLSGLPHPPVLDSMLFGIFLVIYILTVLGNLLILTVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSTGGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSMMGGRMCALLAAGTWFTGSLHSAVQTTLTFHLPYCGPNQIQHYFCDA
PPILKLACADTSANEMVIFVNIGVVASGCFFLISLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRDAVDGIVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
IKYGSVLPQDK