Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10g9 Olfactory Receptor

Gene Symbol Or10g9
Organism Mouse
Family 10
Subfamily g
Pseudo No
Location chr9:40000293-40001225 (-)
Aliases Olfr979, MOR223-1, MOR223-1

Sequence information


Nucleotide sequence

ATGTCAAATGTGACTCTAGTGACCACATTCTTCCTCTCAGGTATTCCCCATCCACCAGCC
CTGGACACCATGCTCTTTGTAGCCTTCTTGGTGATTTACATTCTCACTGTGCTGGGCAAC
TTCCTGATTCTGATGGTAATCAGGGTGGACTCCCACCTCCACACACCCATGTACTACTTC
CTCACCAACCTCTCCTTTATTGATATGTGGTTCTCCACAGTCACAGTACCCAAAATGTTG
ATGACGTTGGTTTCCCCAAGGGGAGGGGCTATCTCCTTCCATAGCTGTGTGGCACAGCTC
TATTGCTTCCACTTCCTGGGTAGCACCGAGTGTTTCCTGTACACTGTCATGTCCTATGAT
CGCTACCTGGCCATCAGTTACCCACTCAGGTACAGCAGCATGATGAGTGGGAGAGTGTGT
GCCCTCCTGGCAGCAGGAACATGGATCACTGGTTCCCTGCACTCTGCTGTCCAGACTACA
TTGACCTTCCGTTTGCCCTACTGTGGTCCCAACCAGATCCAGCATTATTTCTGTGATGCA
CCTCCCATCCTCAAGCTGGCTTGTGCAGACACCTCAGCCAATGAGATGGTCATCTTTGTG
AACATCGGGGTAGTGGCTTCGGGCTGCTTTCTTCTGATTTCGCTGTCCTATGTGTCCATT
GTCTGCTCCATCCTGAGGATTCGTACTTCAGAGGGCCGGCACAGAGCTTTCCAGACATGT
GCCTCACACTGCATCGTGGTCCTCTGTTTCTTTGTGCCCTGTGTTTTTATCTACCTGAGG
CCAGGCTCCAGGGATGCTGTGGATGGAGTTGTGGCTGTTTTCTACACTGTGTTGACACCC
CTACTCAACCCTGTTGTGTACACCCTGAGGAACAAAGAGGTGAAGAAAGCACTAGTTAAA
CTCAAAGACAAAGTAGCATATTCTCAGAGCCAG


Conceptual translation

MSNVTLVTTFFLSGIPHPPALDTMLFVAFLVIYILTVLGNFLILMVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPRGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSMMSGRVCALLAAGTWITGSLHSAVQTTLTFRLPYCGPNQIQHYFCDA
PPILKLACADTSANEMVIFVNIGVVASGCFLLISLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALVK
LKDKVAYSQSQ