Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10g9b Olfactory Receptor

Gene Symbol Or10g9b
Organism Mouse
Family 10
Subfamily g
Pseudo No
Location chr9:40,006,000-40,006,900 (-)
Aliases Olfr980

Sequence information


Nucleotide sequence

MLNGSVVTTFFLSGLPHPPVLDSMLFGIFLVIYILTVLGNLLILMVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSTGGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSMMSGRVCALLAAGTWITGSLHSAVQTTLIFHLPYCGPNEIQHYFCDG
PPILKLACADTSAIEMVIFVNIGVVASGCFFLISLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVTVFYTVLTPLLNPVVYTLRNKEVKKALFK
LKDKVAFSQR


Conceptual translation

MLNGSVVTTFFLSGLPHPPVLDSMLFGIFLVIYILTVLGNLLILMVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSTGGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSMMSGRVCALLAAGTWITGSLHSAVQTTLIFHLPYCGPNEIQHYFCDG
PPILKLACADTSAIEMVIFVNIGVVASGCFFLISLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVTVFYTVLTPLLNPVVYTLRNKEVKKALFK
LKDKVAFSQR