Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10h28 Olfactory Receptor

Gene Symbol Or10h28
Organism Mouse
Family 10
Subfamily h
Pseudo No
Location chr17:33268726-33269673 (+)
Aliases Olfr63, M4, MOR267-1, M4, MOR267-1

Sequence information


Nucleotide sequence

ATGCCCGGTCAGAACTACAGCACCATATCAGAATTTATCCTCTTTGGTTTCTCAGCCTTC
CCACACCAGATGCTCCCTGCTCTGTTCCTGCTCTACTTGCTGATGTATTTGTTCACTCTT
CTGGGGAACCTGGTCATCATGGCTGCTATCTGGACAGAACATAGACTCCACACACCCATG
TACCTCTTCCTGTGTGCCCTCTCCATTTCTGAAATTCTCTTCACTGTCGTCATCACGCCC
CGAATGCTGTCTGACATGCTATCCACCCATCGATCCATCACATTTATAGCTTGTGCTAAC
CAATTGTTTTTCTCCTTCACATTTGGCTACACTCACTCCTTCCTGCTCGTGGTCATGGGC
TATGACCGCTATGTGGCCATCTGCCGCCCCCTGCATTATCATGCACTTATGAGCCTCCAA
GGTTGTGCTCGGCTTGTGGCATGGTCTTGGGCTGGTGGATCGCTTATTGGGATGGCATTG
ACAATAATAATTTTTCACCTTACCTTCTGTGAATCTAATGTGATCCATCACATTCTCTGT
CATGTGTTTTCCCTCTTAAAGTTAGCCTGTGGGGAAAGGACAGCCTTTGTCACTATTGCT
GTGATCCTGGTGTGTGTCACACCCCTCATAGGATGCCTGGTCTTCATTATCCTTTCCTAT
ATCTTTATTGTGGCCGCCATCTTGAGAATCCCATCTACTGAGGGCCGGCACAAGACATTC
TCCACATGTGCATCCCATCTCACTGTAGTGATTGTGCACTACGGCTTTGCCTCCATAATT
TACCTCAAGTCCAGGGGACTCTACTCACAGTACACTGATACCCTCATGTCCACCACCTAT
ACAGTCTTCACCCCCTTCCTTAGTCCAATTATTTTCAGCCTCAGGAATAAGGAGCTGAAG
AATGCTATAATTAAAAGCTTCCACAGGAATGTCTGTCAACAAAGTATC


Conceptual translation

MPGQNYSTISEFILFGFSAFPHQMLPALFLLYLLMYLFTLLGNLVIMAAIWTEHRLHTPM
YLFLCALSISEILFTVVITPRMLSDMLSTHRSITFIACANQLFFSFTFGYTHSFLLVVMG
YDRYVAICRPLHYHALMSLQGCARLVAWSWAGGSLIGMALTIIIFHLTFCESNVIHHILC
HVFSLLKLACGERTAFVTIAVILVCVTPLIGCLVFIILSYIFIVAAILRIPSTEGRHKTF
STCASHLTVVIVHYGFASIIYLKSRGLYSQYTDTLMSTTYTVFTPFLSPIIFSLRNKELK
NAIIKSFHRNVCQQSI