Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10j5 Olfactory Receptor

Gene Symbol Or10j5
Organism Mouse
Family 10
Subfamily j
Pseudo No
Location chr1:172,957,000-172,958,000 (+)
Aliases Olfr16

Sequence information


Nucleotide sequence

MQRNNFTEVIEFVFLGFSSFGKHQITLFVVFLTIYILTLAGNIIIVTITHIDHHLHTPMY
FFLSMLASSETVYTLVIVPRMLSSLIFYNLPISLAGCATQMFFFVTLATNNCFLLTAMGY
DRYVAICNPLRYTIIMSKGMCALLVCGSLGTGLVMAVLHVPAMFHLPFCGTVVEHFFCDI
YPVMKLSCVDTTVNEIINYGVSSFVILVPIGLIFISYVLIVSSILKIVSTEGQKKAFATC
ASHLTVVIVHYGCASIAYLKPKSESSVEKDLLLSVTYTIITPLLNPVVYSLRNKEVKDAL
CRAVGRNTS


Conceptual translation

MQRNNFTEVIEFVFLGFSSFGKHQITLFVVFLTIYILTLAGNIIIVTITHIDHHLHTPMY
FFLSMLASSETVYTLVIVPRMLSSLIFYNLPISLAGCATQMFFFVTLATNNCFLLTAMGY
DRYVAICNPLRYTIIMSKGMCALLVCGSLGTGLVMAVLHVPAMFHLPFCGTVVEHFFCDI
YPVMKLSCVDTTVNEIINYGVSSFVILVPIGLIFISYVLIVSSILKIVSTEGQKKAFATC
ASHLTVVIVHYGCASIAYLKPKSESSVEKDLLLSVTYTIITPLLNPVVYSLRNKEVKDAL
CRAVGRNTS