Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10k2 Olfactory Receptor

Gene Symbol Or10k2
Organism Mouse
Family 10
Subfamily k
Pseudo No
Location chr8:83541047-83542087 (+)
Aliases Olfr370, MOR267-16, MOR267-16

Sequence information


Nucleotide sequence

ATGCTGTACGGCTGTCAATCTCCTGTGCTTCTCGAGTGTGTAAGGATTTCCTCAGTGCCC
TCTCCCCATCTGGGGCTGATCTCTGATGACAGAGCCTCCATGGAGTGTGTAAATGACACT
GTGGTCAGAGAATTTGTCTTCCTTGGCTTCTCGTCTCTGGCTGAGCTGCAGCTGCTACTC
TTTGCCATCTTCCTGTCCCTCTATTTGTTCACTCTGAGCACCAACGCTGTAATTGTTTCC
ACCATTGTGCTAGACAGAGCCCTTCATACGCCCATGTACTTCTTCCTTTCTGTCCTGTCC
TGTTCTGAGACCTGCTACACCTTCGTCATTGTGCCCAAGATGCTGGTTGACTTGCTGGCG
CGGAAGAAGAGCATCTCTTTCCTCGGCTGCGCCATCCAAATGTTCACCTTCCTCTTCCTC
GGCTGTTCTCATTCCTTCCTGCTGGCAGCCATGGGTTATGATCGATACGTGGCCATTTGC
CACCCTCTGCGCTACACGGTGCTCATGGGGCACAGGGTATGCGTGGGGCTAGTAGCTGCT
GCGTGTGTCTGTGGCTTCACTGTGGCACAGGTAATCACATCCCTGGTGTTTCGTCTACCC
TTCCGCTCTTCCAATCAACTCCACCACTTTTTCTGTGACATCTCCCCTGTTCTCCAGTTG
GCATCTCACCACCCTCACTCCACTCAGATCACCATCTTCCTGCTTTGCGCGCTGGTCTTG
GTTATCCCTCTCTTCTTGATCCTGGTATCATATATTCACATCATTTCTACCATCCTCCAA
TTCCCTTCCACGCTGGGCAGGTACAAAGCGTTTTCCACCTGTGCCTCTCACCTCATTGTT
GTCATAGTGCACTATGGATGTGCCTCTTTTATCTACCTAAGGCCCAAGTCCAGCTACTCT
TCCAGCCAGGATGCGCTGATATCAGTATCCTACACTATCCTAACTCCGTTATTCAATCCA
GTCATCTACAGCTTAAGAAACAAAGACTTCAAATCAGCTCTTCATAGGGTAATAGGAAGA
ACAGTTACCCTAAGACAACAC


Conceptual translation

MLYGCQSPVLLECVRISSVPSPHLGLISDDRASMECVNDTVVREFVFLGFSSLAELQLLL
FAIFLSLYLFTLSTNAVIVSTIVLDRALHTPMYFFLSVLSCSETCYTFVIVPKMLVDLLA
RKKSISFLGCAIQMFTFLFLGCSHSFLLAAMGYDRYVAICHPLRYTVLMGHRVCVGLVAA
ACVCGFTVAQVITSLVFRLPFRSSNQLHHFFCDISPVLQLASHHPHSTQITIFLLCALVL
VIPLFLILVSYIHIISTILQFPSTLGRYKAFSTCASHLIVVIVHYGCASFIYLRPKSSYS
SSQDALISVSYTILTPLFNPVIYSLRNKDFKSALHRVIGRTVTLRQH