Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10p1 Olfactory Receptor

Gene Symbol Or10p1
Organism Mouse
Family 10
Subfamily p
Pseudo No
Location chr10:129607550-129608479 (-)
Aliases Olfr796, MOR269-1, MOR269-1

Sequence information


Nucleotide sequence

ATGGATGAGGAAAACCAAACTACAACAACTGAGTTTCTCCTACTGGGGTTCTCTGACCTC
AGAGCCCTTCAGGGGCCACTGTTCTGGTTGGTACTTCTTGTCTACCTGATAACCTTTCTG
GGCAACTCACTGATCATCTTTCTTACCCAAACCAGCCCTGTGCTGCACTCCCCCATGTAT
TTCTTCCTGCGCCATCTTTCCATGGTGGAGCTTCTCTACACCACAGACATTGTGCCCAGA
GTTCTGGCTGACTTGACCTCCTCACATCCCCAGGCCATCTCCTTCAGGAGCTGTGCAGCC
CAGATGTACTTCTTCATTGTCCTGGGTATCTCAGAGTGCTGTCTCCTCACAGCCATGGCC
TATGACCGTTATGCAGCCATCTGTCAGCCCCTGCACTACTCTACCCTAATGAACCACCGG
GCCTGCATAGCCATGGTGGGAACTTCATGGATCATGGGCATCATCACAGCTACCACTCAC
TCTTCCCTCATCTTCACTCTGCCTTTCCCTAGCCGCCCCATCATCCCACACTTCCTCTGT
GACATCCTGCCAGTACTGAGGCTAGCAAGTGCTGGGAAGCACAGGAGTGAAATTTCTGTA
ATGACTGCCACAGTGGTCTTTATCATGATCCCCTTCTCTCTGATAGTTACTTCTTATGCC
CGCATCCTGGGAGCCATCCTGGCAATTGCTTCTAGCCAGAGCCGCCGCAAGGTCTTCTCT
ACCTGCTCCTCCCACTTGCTTGTGGTCTCCCTCTTCTTCGGAACGGCCAGCATCACATAT
ATCAGACCCAGAGCAGGCTCTTCTGTCACCACAGACCGCATCCTTAGTCTCTTCTACACA
GTGGTCACACCCATGCTCAACCCCATCATCTATACCCTCCGGAACAAAGAGGTGATAGGG
GCCCTAAAACACATGAAAAGGCAGGTTCCC


Conceptual translation

MDEENQTTTTEFLLLGFSDLRALQGPLFWLVLLVYLITFLGNSLIIFLTQTSPVLHSPMY
FFLRHLSMVELLYTTDIVPRVLADLTSSHPQAISFRSCAAQMYFFIVLGISECCLLTAMA
YDRYAAICQPLHYSTLMNHRACIAMVGTSWIMGIITATTHSSLIFTLPFPSRPIIPHFLC
DILPVLRLASAGKHRSEISVMTATVVFIMIPFSLIVTSYARILGAILAIASSQSRRKVFS
TCSSHLLVVSLFFGTASITYIRPRAGSSVTTDRILSLFYTVVTPMLNPIIYTLRNKEVIG
ALKHMKRQVP