Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10q1 Olfactory Receptor

Gene Symbol Or10q1
Organism Mouse
Family 10
Subfamily q
Pseudo No
Location chr19:13749108-13750052 (+)
Aliases Olfr1494, MGC123672, MGC123731, MGC123732, MOR266-1, MGC123672, MGC123731, MGC123732, MOR266-1

Sequence information


Nucleotide sequence

ATGCTGACTGGGAAGTCTGTCCTCAATCAGTCTGGGACCACTGAGTTTGTGTTCCGTGTC
TTCACCACTGTCCCTGAATTCCAGGCTCTTCTCTTCCTCCTCTTCCTCCTGCTGTATTTG
ATGATCCTCTGTGGTAATGCAGCCATCATCTGGGTAGTGTGCACACACAGTGCCCTGCAC
ACACCTATGTATTTCTTCCTCAGTAGTCTGTCTGTCTTGGAAATCTTCTACACCACAGAT
GTGGTGCCCTTGATGCTTTCTAACATCTTTGGGGCCCAGAAACCCATATCACTGGCTGGT
TGTGGGACACAAATGTTCTTCTTTGTAACTCTAGGAAGCACTGACTGCTTTCTCTTGGCA
GTCATGGCCTATGACAGGTATGTGGCCATCTGCCACCCTCTACACTACAGCCTCATCATG
ACCAAGAAGCTGTGTGTCCAGATGGTGATGGGCTCTTGGAGCTTGGCACTGTTTCTCTCC
CTGCAGCTCACTGCCTTAATTTTCACCTTGCCCTTCTGTGGACATGACCAGGAAATCAAC
CACTTTCTCTGTGATGTGCCTCCAGTCCTGCGCCTAGCCTGTGCTGACATTCATGTGCAC
CAGGCAGTCCTCTATGTAGTGGGCATCCTGGTGCTGACAGTCCCATTCCTGCTGATTTGT
ATCTCATATGTGTTCATTGCTTCTACAATTCTTCGCATGCGCTCTGCAGAGGGTCGCCAG
AGGGCCTTCTCTACCTGCTCCTCCCACCTCACTGTGGTCTTGCTGCAGTATGGTTGCTGC
AGCCTTGTATATCTGAGGCCCCGCTCCAGCACCTCAGAGGATGAGGATCGCCAAATTGCC
CTGGTCTACACCTTTGTCACGCCATTACTCAATCCTCTGATTTACACCCTTCGGAATAAA
GATGTGAAAGGTGCACTGAAGAACTCCATCTTCCATAAAGCAGTC


Conceptual translation

MLTGKSVLNQSGTTEFVFRVFTTVPEFQALLFLLFLLLYLMILCGNAAIIWVVCTHSALH
TPMYFFLSSLSVLEIFYTTDVVPLMLSNIFGAQKPISLAGCGTQMFFFVTLGSTDCFLLA
VMAYDRYVAICHPLHYSLIMTKKLCVQMVMGSWSLALFLSLQLTALIFTLPFCGHDQEIN
HFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFLLICISYVFIASTILRMRSAEGRQ
RAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYTFVTPLLNPLIYTLRNK
DVKGALKNSIFHKAV