Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10q1b Olfactory Receptor

Gene Symbol Or10q1b
Organism Mouse
Family 10
Subfamily q
Pseudo No
Location chr19:13704790-13705785 (+)
Aliases Olfr1491, MOR266-8, MOR266-8

Sequence information


Nucleotide sequence

ATGTTTGTGAATTCAATCACTGTTCTTCTTGCAGAAGATATGTTGACTGGAAAACTTGTC
CTTAACCAATCTGGGACTCCTGAGTTCGTGTTCCGTGTCTTCACCAATGCTCCTGAATTC
CAGGCTCTTCTCTTCACCCTCTTCCTCCTGCTGTATCTGATGATCTTCTGTGGCAACACT
GCCATCATCTGGGTGGTGTGCACCCACACTTCCTTGCACACACCCATGTATTTCTTCCTC
AGTAGTCTGTCTTTCCTGGAAATATGCTACACCACAGATGTGGTACCCCTGATGCTTTCT
AACATCTTTGGGACCCAGAAGCCTATATCGCTGGCTGGTTGTGGGACTCAAATGTTCTTC
TTCCTCACTCTGGGAGGTACTGATTGCTTTCTCTTGGCAATTATGGCCTATGACAGGTAT
GTGGCCATCTGCCACCCTCTGCACTACAACCTCATCATGACCAAGAAGCTGTGTGTTCAG
ATGGTGATGGGCTCTTTAAGCTTGGCACTGTTTCTCTCCCTGCAGCTCACTGCCTTAATT
TTCACCCTGCCCTTCTGTGGACATTACCTGGAAATCAACCACTTTCTTTGTGATGTGCCT
CCAGTCCTGCGCCTAGCCTGTGCTGACATTCATGTGCACCAGGCAGTCCTCTACGTAGTG
GGCATCCTGGTGCTGACAGTCCCATTCTTGCTTATCTTCATTTCCTATGTGTTCATTGTT
TCCACCATCCTGCGCATGCGCTCTGCAGAGGGTCGCCAAAGGGCCTTTTCCACCTGCTCT
TCTCACCTCACTGTGGTCTTGCTACAGTATGGTGGCTGTAGCTTGGTGTACCTGAGGCCC
CGCTCGAGCAGCTCTGATGATGAGGACCGGCAAATAGCCCTGGTCTACACCTTTGTGACT
CCATTACTCAACCCTCTGATTTATACCCTTAGGAACAAGGATGTCAAAGGTGCTCTGAGG
AACTCCATCTTCTGTAAATCAGCATCTCACTGTAGT


Conceptual translation

MFVNSITVLLAEDMLTGKLVLNQSGTPEFVFRVFTNAPEFQALLFTLFLLLYLMIFCGNT
AIIWVVCTHTSLHTPMYFFLSSLSFLEICYTTDVVPLMLSNIFGTQKPISLAGCGTQMFF
FLTLGGTDCFLLAIMAYDRYVAICHPLHYNLIMTKKLCVQMVMGSLSLALFLSLQLTALI
FTLPFCGHYLEINHFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFLLIFISYVFIV
STILRMRSAEGRQRAFSTCSSHLTVVLLQYGGCSLVYLRPRSSSSDDEDRQIALVYTFVT
PLLNPLIYTLRNKDVKGALRNSIFCKSASHCS