Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10w1 Olfactory Receptor

Gene Symbol Or10w1
Organism Mouse
Family 10
Subfamily w
Pseudo No
Location chr19:13654431-13655393 (+)
Aliases Olfr1490, MOR266-6P, MOR266-6P

Sequence information


Nucleotide sequence

ATGGCTGTGGATTCAATGACTTGGAAGAACCACTCATTGTTCATGGAATTTGTGTTCCTT
GCCTATCCAAAACGTCCAGAGCTACGTATGCTCTGCTTCTTTGGAGTTAGCCTGGCTTAT
GGATTGATAATCTCTGGGAATATCCTTATTGTGGTCTCCATCCAGACTGAAACACGTCTA
CATACACCCATGTACTATTTCCTGGGCAGCCTCTCAGGGATAGAGCTATGTTACACTGCA
GTGGTGGTACCACACATTTTGGCCAACAACTTTCAGTCTGAGAAGACCATTTCTCTGCTG
AGCTGTGCCACTCAGATGGTTTTCCTCATTGGACTTGGTAGTGCTGATTGCTTCCTCCTG
GCTATCATGGCCTATGACAGATATGTTGCCATCTGTCATCCTTTGCAGTACCCTCTCATC
ATGACTATAACACTTTGTGTTCGCTTGGTTGTGGCTTCTGTGGTCATTGGCTTGTTCCTG
TCCTTACAGCTTGTGGTCTTTATCTTCTGTCTACCATTCTGTCAGGACAGGGGAATAGAG
CACTTCTTTTGTGATGCTCCACCACTGATGCGTCTCGTGTGTGCCACAAGTCATATCCAT
GAGCTCTCTGTGCTAATGGCAGCCACACTAGCCATTGCTGTGCCTTTCTTTTTCATTGCC
ACCACCTATGCCTTGATAGTGGCTGCTGTGCTCAAACTCCACTCAGCAGCTGGCCGTCAC
AGGGCCTTCAACACTTGTTCTTCCCACCTCACTGTGGTATTGTTGCAGTATGGCTGCTGT
GCCTTCATGTACTTGCGCCCCGTCTCCAGTTACCATCCCAAGCAAGATCAGTTTGTCTCC
CTGGTATACACACTGGGTACACCATTCCTCAATCCCCTCATCTACACTCTGAGGAACAGT
GAGATGAAAGGGGCCATAGGAAAAGTGCTTACCAGAAAGTATCTTTCATGGAAAATGATA
GGA


Conceptual translation

MAVDSMTWKNHSLFMEFVFLAYPKRPELRMLCFFGVSLAYGLIISGNILIVVSIQTETRL
HTPMYYFLGSLSGIELCYTAVVVPHILANNFQSEKTISLLSCATQMVFLIGLGSADCFLL
AIMAYDRYVAICHPLQYPLIMTITLCVRLVVASVVIGLFLSLQLVVFIFCLPFCQDRGIE
HFFCDAPPLMRLVCATSHIHELSVLMAATLAIAVPFFFIATTYALIVAAVLKLHSAAGRH
RAFNTCSSHLTVVLLQYGCCAFMYLRPVSSYHPKQDQFVSLVYTLGTPFLNPLIYTLRNS
EMKGAIGKVLTRKYLSWKMIG