Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or11a4 Olfactory Receptor

Gene Symbol Or11a4
Organism Mouse
Family 11
Subfamily a
Pseudo No
Location chr17:37225127-37226065 (+)
Aliases Olfr96, MOR121-1, MOR121-1

Sequence information


Nucleotide sequence

ATGGGAATCCTTTCCACAGGAAATCAAACTGTCACTGAGTTTGTACTTCTTGGTTTCCAT
GAAGTCCCTGGGCTGCACCTCCTGTTTTTTTCTGTGTTCACCATCCTCTATGCCTCCATC
ATCACAGGGAACATGCTCATTGCAGTGGTGGTGGTGAGCTCCCAGAGGCTTCACACACCC
ATGTATTTCTTTCTGGTGAATCTGTCCTTCATAGAGATTGTCTATACCTCCACAGTGGTG
CCCAAAATGCTGGAAGGCTTCTTACAGGAGGCCACCATATCTGTGGCTGGCTGCTTGCTC
CAGTTCTTTGTTTTTGGCTCTCTGGCCACAGATGAGTGTTTTCTGCTGGCTGTGATGGCA
TATGATCGATATCTCGCAATTTGTCACCCTCTACGATACCCACACCTCATGGGGCCTCAA
TGGTGCCTGGGGTTGGTGCTCACAGTCTGGCTGTCTGGCTTCATGGTAGATGGACTAGTT
GTTGCTCTGATGGCCCAGTTGAGATTCTGTGGCCCCAACTTAGTTGATCACTTTTACTGT
GATTTTTCACCTTTGATGGTCCTGGCTTGCTCAGATACCCAAGTGGCCCAGGTGACTACA
TTTGTTCTCTCTGTGGTCTTCCTGACTGTCCCCTTTGGGCTGGTTCTGATCTCCTATGCT
CAGATTGTAGTGACTGTGCTGAGAGTTCCTTCTGGGACCAGAAGAACCAAGGCCTTCTCC
ACATGCTCCTCTCACCTGGCTGTGGTGTCCACGTTCTATGGAACACTCATGGTATTGTAC
ATTGTGCCCTCTGCTGTTCATTCTCAGCTCCTCTCCAAGGTCATTGCCCTGCTCTACACA
GTGGTCACTCCCATCTTCAACCCTGTCATCTACACCTTGAGGAACCAGGAGGTGCAGCAG
GCACTAAGAAGGCTTCTCTACTGCAAACCAACTGAAATG


Conceptual translation

MGILSTGNQTVTEFVLLGFHEVPGLHLLFFSVFTILYASIITGNMLIAVVVVSSQRLHTP
MYFFLVNLSFIEIVYTSTVVPKMLEGFLQEATISVAGCLLQFFVFGSLATDECFLLAVMA
YDRYLAICHPLRYPHLMGPQWCLGLVLTVWLSGFMVDGLVVALMAQLRFCGPNLVDHFYC
DFSPLMVLACSDTQVAQVTTFVLSVVFLTVPFGLVLISYAQIVVTVLRVPSGTRRTKAFS
TCSSHLAVVSTFYGTLMVLYIVPSAVHSQLLSKVIALLYTVVTPIFNPVIYTLRNQEVQQ
ALRRLLYCKPTEM