Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or11h6 Olfactory Receptor

Gene Symbol Or11h6
Organism Mouse
Family 11
Subfamily h
Pseudo No
Location chr14:50,642,300-50,643,300 (+)
Aliases Olfr745

Sequence information


Nucleotide sequence

MITHFSVVSVFLTAFGSKNSSIHFVTEFILLGFSNQGEMQSFFFCSILILYLLTLLGNGT
IVCAVRWDQRLHTPMYIFLGNFAFLEIWYVSSTIPNMLVNILSENKTISFSACFLQFYFF
FSLGTTECFFLSAMAYDRYLAICRPLHYPSIMTRKFCVILICICWVSGFLCYPVPIVLIS
QLPFCGPNIIDHFVCDPGPLFALSCVPAPSTELLCYTFNSMIIFGPFFCILGSYTLVLRA
VFRVPSGAGRTKAFSTCGSHLVVVSLFYGTLMVMYVSPTSGNPAGMQKIVTLIYSALTPL
LNPLIYTLRNKEMKNALKKLLKLTTIQN


Conceptual translation

MITHFSVVSVFLTAFGSKNSSIHFVTEFILLGFSNQGEMQSFFFCSILILYLLTLLGNGT
IVCAVRWDQRLHTPMYIFLGNFAFLEIWYVSSTIPNMLVNILSENKTISFSACFLQFYFF
FSLGTTECFFLSAMAYDRYLAICRPLHYPSIMTRKFCVILICICWVSGFLCYPVPIVLIS
QLPFCGPNIIDHFVCDPGPLFALSCVPAPSTELLCYTFNSMIIFGPFFCILGSYTLVLRA
VFRVPSGAGRTKAFSTCGSHLVVVSLFYGTLMVMYVSPTSGNPAGMQKIVTLIYSALTPL
LNPLIYTLRNKEMKNALKKLLKLTTIQN