Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12d2 Olfactory Receptor

Gene Symbol Or12d2
Organism Mouse
Family 12
Subfamily d
Pseudo No
Location chr17:37313459-37314382 (-)
Aliases Olfr102, MOR250-4, MOR250-4

Sequence information


Nucleotide sequence

ATGTCTAATCAAACCTCAGTCACTGAATTTCTCCTCCTGGGAGTAACAGATATACAAGAA
TTAAACCCTATTCTCTTTGTGGTTTTCTTCACAATCTACTTTGTCAATATAACTGGGAAT
GGAGCCATCCTGATGATTGTCATCTTGGACCCAAGACTCCACTCACCTATGTATTTCTTC
CTGGGAAACCTAGCATGTCTAGATATCTGCTTCTCCACTGTGACACTGCCAAAGATGCTG
CAGAACCTCCTCTCCACAAGCAAAGCAATTTCCTTCTTGGGATGCATAACTCAGCTCCAT
TTCTTCCACTTCCTGGGTAGCACTGAGGCCATGCTGCTGCCAGTGATGGCATTTGACCGC
TTTGTGGCTATCTGCAGACCACTCCACTATTCTGTGATCATGAATCACCAGCTCTGTATT
CACATGACTGTTACTATCTGGACCCTGGGCTTTTTCCATGCCTTACTTCACTCTGTAATG
ACATCTCGTTTGAGCTTCTGTGGTCCCAATCATGTCCATCATTTCTTCTGTGATATTAAG
CCATTGTTGGATCTGGCCTGTGGAAACACTGAGCTCAACCTTTGGCTGCTCAATACAGTC
ACAGGCACCATTGCCCTCACTCCCTTTTTTCTGACATTTCTCTCCTATTTCTACATCATC
ACCTATCTTTTCCTCAAGACTCGTTCTTGCAGCATGCTCCACAAAGCTCTGTCTACCTGT
GCCTCCCACTTCATGGTTGTGATTCTGCTCTATGTTCCAGTTCTCTTCACCTACATCCGT
CCTGCCTCAGGCAGCTCTCTGGATCAGGACAGAATCATTGCCATCATGTACAGTGTGGTC
ACCCCTGCTCTCAATCCACTCATCTACACCTTGAGAAACAAGGAAGTGAGGAGTGCATTG
AATAGAAAGGTGAGAAGATGGCTC


Conceptual translation

MSNQTSVTEFLLLGVTDIQELNPILFVVFFTIYFVNITGNGAILMIVILDPRLHSPMYFF
LGNLACLDICFSTVTLPKMLQNLLSTSKAISFLGCITQLHFFHFLGSTEAMLLPVMAFDR
FVAICRPLHYSVIMNHQLCIHMTVTIWTLGFFHALLHSVMTSRLSFCGPNHVHHFFCDIK
PLLDLACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYIITYLFLKTRSCSMLHKALSTC
ASHFMVVILLYVPVLFTYIRPASGSSLDQDRIIAIMYSVVTPALNPLIYTLRNKEVRSAL
NRKVRRWL