Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13c25 Olfactory Receptor

Gene Symbol Or13c25
Organism Mouse
Family 13
Subfamily c
Pseudo No
Location chr4:52,910,800-52,911,800 (-)
Aliases Olfr272

Sequence information


Nucleotide sequence

MEMTNDSMLTEFLLVGLSDHPKLQTVLFVLVLCMYLMILLGNGVLIAVVIHDIRLHTPMY
FFLCNLSFLDICYTSSSVPLILSSFLTVRKRVSFSECMIQMFFSFAMGATECVLLGTMAL
DRFMAICYPLRYPVIMSKDTYVPMAAGCWVAGLVDSVVQTSLAVQLPFCTNNVIHHFVCE
ILGILELACADISINVISLTGSNLLFLAVPLLVIAVSYMFIIATILRIPSAEGKRKAFST
CSAHLTVVIIFYGTIFSMYAKPKSKDTAGAGHQSVMEALISLFYGVMTPMLNPLIYSLRN
KDVKAAVQNMLGRKTLSKM


Conceptual translation

MEMTNDSMLTEFLLVGLSDHPKLQTVLFVLVLCMYLMILLGNGVLIAVVIHDIRLHTPMY
FFLCNLSFLDICYTSSSVPLILSSFLTVRKRVSFSECMIQMFFSFAMGATECVLLGTMAL
DRFMAICYPLRYPVIMSKDTYVPMAAGCWVAGLVDSVVQTSLAVQLPFCTNNVIHHFVCE
ILGILELACADISINVISLTGSNLLFLAVPLLVIAVSYMFIIATILRIPSAEGKRKAFST
CSAHLTVVIIFYGTIFSMYAKPKSKDTAGAGHQSVMEALISLFYGVMTPMLNPLIYSLRN
KDVKAAVQNMLGRKTLSKM