Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13c7 Olfactory Receptor

Gene Symbol Or13c7
Organism Mouse
Family 13
Subfamily c
Pseudo No
Location chr4:43854311-43855267 (+)
Aliases Olfr155, RP23-9F18.8, GA_x5J8B7W5BNN-979337-980296, MG, RP23-9F18.8, GA_x5J8B7W5BNN-979337-980296, MG

Sequence information


Nucleotide sequence

ATGGACAGATCCAATGAGACCGCCCCCCTGTCCGGCTTCATTCTCCTGGGCCTCTCTGCC
CACCCAAAGCTGGAGAAAACCTTCTTCGTGCTCATCCTGATGATGTACCTGGTGATCCTG
CTGGGCAACGGCGTCCTCATCCTGGTGAGCATCCTCGACTCCCACCTGCACACGCCCATG
TACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACTACCTCCTCTGTCCCC
CTCATTCTGGACAGCTTTCTGACTCCCAGGAAGACCATCTCCTTCTCGGGCTGTGCCGTG
CAGATGTTTCTCTCCTTCGCCATGGGAGCCACGGAGTGTGTGCTCCTGAGTATGATGGCG
TTTGATCGTTATGTGGCCATCTGCAACCCCCTTAGATATCCTGTGGTCATGAACAAGGCT
GCCTATGTGCCCATGGCTGCCAGTTCCTGGGCAGGTGGTATCACTAATTCTGTAGTGCAG
ACATCTTTGGCAATGCGGCTGCCCTTCTGTGGGGACAATGTCATCAATCACTTCACCTGT
GAGATCCTGGCAGTCCTGAAACTGGCCTGTGCTGACATCTCCATCAATGTCATCAGCATG
GTTGTGGCCAACATGATCTTCTTGGCAGTCCCAGTCCTCTTCATCTTTGTCTCCTATGTC
TTCATCCTTGTGACAATCCTGAGGATCCCCTCTGCTGAGGGGAGGAAGAAGGCCTTCTCC
ACCTGCTCTGCCCACCTCACCGTGGTACTTGTCTTCTATGGAACCATCCTCTTCATGTAC
GGGAAGCCCAAGTCCAAGGACCCACTGGGGGCAGACAAGCAGGACCTTGCAGACAAGCTC
ATCTCCCTCTTCTATGGAGTGGTGACCCCCATGCTAAACCCCATCATCTACAGCTTGAGA
AACAAGGACGTGAGGGCTGCTGTGAGGAACCTGGTGGGCCAGAAACACCTAACTGAG


Conceptual translation

MDRSNETAPLSGFILLGLSAHPKLEKTFFVLILMMYLVILLGNGVLILVSILDSHLHTPM
YFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGATECVLLSMMA
FDRYVAICNPLRYPVVMNKAAYVPMAASSWAGGITNSVVQTSLAMRLPFCGDNVINHFTC
EILAVLKLACADISINVISMVVANMIFLAVPVLFIFVSYVFILVTILRIPSAEGRKKAFS
TCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLR
NKDVRAAVRNLVGQKHLTE