Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13c7b Olfactory Receptor

Gene Symbol Or13c7b
Organism Mouse
Family 13
Subfamily c
Pseudo No
Location chr4:43820406-43821359 (-)
Aliases Olfr156, RP23-9F18.6, MGC123974, MGC123975, MGC123977,, RP23-9F18.6, MGC123974, MGC123975, MGC123977,

Sequence information


Nucleotide sequence

ATGGAAGGAGCCAATCAGTCTACGGTAGCTGAATTTGTCTTGCTGGGGTTGTCAGATCAC
CCAAAGCTGGAGAAAACCTTCTTCGTGCTCATCCTGCTGATGTACCTGGTGATCCTGCTG
GGCAACGGCGTCCTCATCCTGGTGAGCATCCTCGACTCCCACCTGCACACGCCCATGTAC
TTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTATACTACCTCCTCGATTCCCTTA
GTCCTGGATGGTTTTCTCACCCCCAGGAAGACCATCTCCTTCTCGGGCTGTGCCGTGCAG
ATGTTTCTCTCCTTTGCCATGGGAGCCACGGAGTGTGTGCTCCTGGGCATGATGGCGTTT
GATCGTTATGTGGCCATCTGCAACCCTCTTAGATACCCTGTGGTCATGAACAAGTCTGCC
TATGTGCCCATGGCCGTCAGCTCCTGGGTGGCTGGCGGTGCTAACTCCTTGGTGCAGATC
TCCCTTGCGGTGCAGTTGCCTTTCTGTGGGGACAATGTCATCAATCACTTCACCTGTGAG
ATCCTAGCAGTCTTAAAGCTAGCCTGTGCTGACATCTCCATCAATGTGATCAGCATGGGG
GTGGCCAATGTGATTTTCCTGGGGGTTCCAGTTCTGTTCATCTTTGTCTCCTACATCTTC
ATACTCTCCACCATCCTGAGGATCCCCTCTGCCGAGGGGAGGAAGAAGGCCTTCTCCACC
TGTTCTGCCCACCTCACCGTGGTACTTGTCTTCTATGGGACCATCCTGTTCATGTACGGG
AAGCCCAAGTCCAAGGACCCATTGGGGGCAGACAAACAGGATGTTTCAGACAAGCTCATC
TCCTTATTTTATGGGGTGCTGACCCCCATGCTGAACCCCATCATCTACAGCCTGAGGAAC
AAGGATGTGAAGGCCGCTGTGAGGAACCTGGTAGGTCAGAAATGCCTGATTCAG


Conceptual translation

MEGANQSTVAEFVLLGLSDHPKLEKTFFVLILLMYLVILLGNGVLILVSILDSHLHTPMY
FFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAVQMFLSFAMGATECVLLGMMAF
DRYVAICNPLRYPVVMNKSAYVPMAVSSWVAGGANSLVQISLAVQLPFCGDNVINHFTCE
ILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIFILSTILRIPSAEGRKKAFST
CSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDVSDKLISLFYGVLTPMLNPIIYSLRN
KDVKAAVRNLVGQKCLIQ