Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13c7c Olfactory Receptor

Gene Symbol Or13c7c
Organism Mouse
Family 13
Subfamily c
Pseudo No
Location chr4:43835535-43836488 (-)
Aliases Olfr157, RP23-9F18.7, MOR262-12, OR37C, Olfr37c, mOR37, RP23-9F18.7, MOR262-12, OR37C, Olfr37c, mOR37

Sequence information


Nucleotide sequence

ATGGATGTATCCAACCAGACGACTGTAACAGAATTTGTCCTGTTGGGCCTCTCCGCCCAC
CCCAAACTGGAGAAAACCTTCTTCGTGCTCATCTTGTCAATGTACCTGGTGATCCTGCTG
GGCAACGGGGTCCTCATCCTGGTGAGCATCCTCGACTCCCACCTGCACACGCCCATGTAC
TTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACCACCTCCTCCGTTCCCTTA
GTCCTTGATGGTTTTCTGACCCCCAGGAAGACCATCTCCTTCTCGGGCTGTGCCGTGCAG
ATGTTTCTCTCCTTCGCCATGGGAGCCACAGAGTGTGTGCTCCTGGGCATGATGGCGTTT
GATCGTTATGTGGCCATCTGCAACCCCCTTAGATACCCTGTGGTCATGAACAAGGCTGCC
TATGTGCCCATGGCCGTCAGCTCCTGGGTGGCTGGCGGTGCTAACTCCTTGGTGCAGATC
TCCCTTGCGGTGCAATTGCCTTTCTGTGGGGACAATGTCATCAATCATTTCATCTGTGAG
ATCCTGGCAGTCTTAAAGCTAGCCTGTGCTGACATCTCCATCAATGTGATCAGCATGGGG
GTGGCCAATGTGATTTTCCTGGGGGTTCCAGTTCTGTTCATCTTTGTCTCCTACATCTTC
ATACTCTCCACCATCTTGAGGATCCCCTCTGCTGAGGGGAGGAAGAAGGCCTTCTCCACC
TGCTCTGCCCACCTCACCGTGGTGATCATTTTTTATGGGACCATCCTCTTCATGTACGGG
AAGCCCAAGTCCAAGGACCCACTGGGGGCAGACAAGCAGGACCTTGCAGACAAGCTCATC
TCCCTCTTCTATGGACTGCTGACCCCCATGCTGAACCCCATCATCTACAGCCTGAGGAAC
AAGGACGTGAAGGCCGCTGTGAGGAACCTGGCAAGTCACAGATGCCTCACCTTC


Conceptual translation

MDVSNQTTVTEFVLLGLSAHPKLEKTFFVLILSMYLVILLGNGVLILVSILDSHLHTPMY
FFLGNLSFLDICYTTSSVPLVLDGFLTPRKTISFSGCAVQMFLSFAMGATECVLLGMMAF
DRYVAICNPLRYPVVMNKAAYVPMAVSSWVAGGANSLVQISLAVQLPFCGDNVINHFICE
ILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIFILSTILRIPSAEGRKKAFST
CSAHLTVVIIFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGLLTPMLNPIIYSLRN
KDVKAAVRNLASHRCLTF