Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13c7d Olfactory Receptor

Gene Symbol Or13c7d
Organism Mouse
Family 13
Subfamily c
Pseudo No
Location chr4:43770053-43771009 (-)
Aliases Olfr159, RP23-9F18.2, MOR262-5, Olfr37e, mOR37e, RP23-9F18.2, MOR262-5, Olfr37e, mOR37e

Sequence information


Nucleotide sequence

ATGGAGAGATCCAACAAGACCACCCCTGTGTCCAGCTTCATCCTCCTGGGTCTCTCCGCC
CACCCAAAGCTGGAGAAAACCTTCTTCGTGCTCATCCTGCTGATGTACCTGGTGATCCTG
CTGGGCAATGTCGTCCTCATCCTGGTGAGCATCCTCGACTCCCACCTGCACACGCCCATG
TACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACCACCTCCTCCGTCCCC
CTCATTCTGGACAGCTTCCTGACCCCCAGGAAGACCATCTCCTTCTCGGGCTGTGCCGTG
CAGATGTTTCTCTCCTTCGCCATGGGAGCCACAGAGTGTGTGCTCCTGGGCATGATGGCG
TTTGATCGTTATGTGGCCATCTGCAACCCCCTTAGATATCCTGTGGTCATGAGCAAGGCT
GCCTATGTGCCCATGGCCGCCGGCTCCTGGGTATCTGGAAGCATCACTGCCACAGTGCAG
ATATCTTTAGCAATGACACTGCCCTTCTGTGGGGACAATGTCATCAATCACTTTACATGT
GAGATCCTGGCAGTCCTGAAACTGGCCTGTGCTGACATCTCCATCAATGTCATCAGCATG
GCAGTGGCTAATGCAATGTTTTTGGGGGTCCCTGTCCTCTTCATCTTTGTCTCCTACATC
TTCATACTCTCCACCATCCTGAGGATCCCCTCTGCCGAGGGGAGGAAGAAGGCCTTCTCC
ACCTGCTCTGCCCACCTCACCGTGGTACTTGTCTTCTATGGGACCATCCTGTTCATGTAC
GGGAAGCCCAAATCCAAGGACCCATTGGGGGCAGACAAACAGGACCTTGCAGACAAGCTC
ATCTCCCTCTTCTATGGAGTGGTGACCCCCATGCTGAACCCCATCATCTACAGCCTGAGG
AACAAGGATGTGAAGGCCGCTGTGACAAACCTGGTGGGCCAGAAACACTTCAAGTGG


Conceptual translation

MERSNKTTPVSSFILLGLSAHPKLEKTFFVLILLMYLVILLGNVVLILVSILDSHLHTPM
YFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGATECVLLGMMA
FDRYVAICNPLRYPVVMSKAAYVPMAAGSWVSGSITATVQISLAMTLPFCGDNVINHFTC
EILAVLKLACADISINVISMAVANAMFLGVPVLFIFVSYIFILSTILRIPSAEGRKKAFS
TCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLR
NKDVKAAVTNLVGQKHFKW