Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13d1 Olfactory Receptor

Gene Symbol Or13d1
Organism Mouse
Family 13
Subfamily d
Pseudo No
Location chr4:52,970,600-52,971,600 (+)
Aliases Olfr270

Sequence information


Nucleotide sequence

MKMGNYSAVTEFFLVGLSQYPELQLFLFVLCLIMYLIILLGNSLLIIISILDSRLHTPMY
FFLGNLSFLDICYTSSSIPQMLIMFMSARKSISFLGCALQMVISLGLGSTECVLLAVMAY
DRYAAICNPLRYPIIMNKVLYVHMAVWSWVIGCLNSLVQTVLTMVLPFCGNNVIDHLTCE
ILALLKLVCSDITMNVLIMTVASIVLLMIPLMLIFVSYIFILSSILRINSAEGRKKAFST
CSAHLTVVILFYGSALFMYMKPKSKYTKASDEIIGLSYGVVTPMLNPIIYSLRNKEVKEA
VKKILSKRLYLRKI


Conceptual translation

MKMGNYSAVTEFFLVGLSQYPELQLFLFVLCLIMYLIILLGNSLLIIISILDSRLHTPMY
FFLGNLSFLDICYTSSSIPQMLIMFMSARKSISFLGCALQMVISLGLGSTECVLLAVMAY
DRYAAICNPLRYPIIMNKVLYVHMAVWSWVIGCLNSLVQTVLTMVLPFCGNNVIDHLTCE
ILALLKLVCSDITMNVLIMTVASIVLLMIPLMLIFVSYIFILSSILRINSAEGRKKAFST
CSAHLTVVILFYGSALFMYMKPKSKYTKASDEIIGLSYGVVTPMLNPIIYSLRNKEVKEA
VKKILSKRLYLRKI