Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or14a259 Olfactory Receptor

Gene Symbol Or14a259
Organism Mouse
Family 14
Subfamily a
Pseudo No
Location chr7:86,363,400-86,364,300 (-)
Aliases Olfr305

Sequence information


Nucleotide sequence

MPNVTAVTGFILMGFSDIHELQILCGVLFLVLYLGILMSNLLIIILITVDLKLQTPMYFF
LKNLSLLDVFLVSVTIPNFFVNSLMHKNSISILGCAFQVFFMALLGSGEVFVLTTMSYDR
YVAICSPLHYEVIMNSVTCVVMMSVSWGTGLFFGVMYTAGTFSMTFCGSNVIPQIFCDVP
SLLRISCSGSLMIIYISLGIGVCLGMSCFICVVISYIYIFSTVLKIPTTKGQSKAFGTCI
PHLTVFSVFIATACFVYLKPPSNSASLTDRLFSVLYTVLPPALNPVIYSLRNNDVDSALK
RLLQNLYSRDFLHVIHQNV


Conceptual translation

MPNVTAVTGFILMGFSDIHELQILCGVLFLVLYLGILMSNLLIIILITVDLKLQTPMYFF
LKNLSLLDVFLVSVTIPNFFVNSLMHKNSISILGCAFQVFFMALLGSGEVFVLTTMSYDR
YVAICSPLHYEVIMNSVTCVVMMSVSWGTGLFFGVMYTAGTFSMTFCGSNVIPQIFCDVP
SLLRISCSGSLMIIYISLGIGVCLGMSCFICVVISYIYIFSTVLKIPTTKGQSKAFGTCI
PHLTVFSVFIATACFVYLKPPSNSASLTDRLFSVLYTVLPPALNPVIYSLRNNDVDSALK
RLLQNLYSRDFLHVIHQNV