Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1a1 Olfactory Receptor

Gene Symbol Or1a1
Organism Mouse
Family 1
Subfamily a
Pseudo No
Location chr11:74195505-74196443 (+)
Aliases Olfr403, RP23-20M18.8, IA7, MGC129218, MOR125-5_p, Olf, RP23-20M18.8, IA7, MGC129218, MOR125-5_p, Olf

Sequence information


Nucleotide sequence

ATGAGAGAAGAAAATGAGTCTTCTACCATAGATTTCACTCTCCTGGGAGTTACAAGGCAG
CGGGAGCAGGAATATTTCTTCTTCATCCTCTTCCTGTTCATTTACCCCATCACAGTGTTT
GGGAACATGCTCATCATCCTAGCCATTCACTCTGACACTCGCCTCCATAACCCTATGTAC
TTTTTCCTGGCCAACCTCTCCCTTGTTGACATCTTCTTCTCCTCTGTAACTATTCCCAAG
ATGCTGGCCAACCATCTCCTAGGTAGCAAGGCCATCTCCTTTGGGGGATGTATGGCACAG
ATGTACTTCATGATATCATTGGGAAACACAGACAGTTATATACTAGCTGCAATGGCATAT
GACCGAGCTGTGGCTATCAGTCGCCCGCTTCATTATGCAACAATTATGAGTCCACAACTT
TGTGTCCTGCTGGTTGCTGGGTCCTGGGTGATTGCAAATGCTAATGCACTGCCCCACACC
CTACTCACAGCTAGATTGTCCTTCTGTGGCAATAAGGATGTGGCCAACTTCTACTGTGAC
ATTACACCTTTGCTCCAGCTGTCCTGTTCTGACATCCGCTTCAATGTGAAGATGATGTAC
CTTGGGGTGGGGGTCTTCTCTGTGCCACTGCTGTGCATCATCATCTCCTATGTCCGGGTC
TTTTCCACAGTCTTGCGGGTTCCATCTACCAAGGGCTTCCTGAAGGCCTTGTCCACCTGT
GGCTCTCACCTGACAGTGGTGTCCTTGTATTATGGGACAGTCATGGGCATGTATTTCCGG
CCCCTGACCAGTTACAGTCTGAAGCATGCATTGATAACTGTGATGTACACGGCAGTGACC
CCAATGCTGAACCCTTTCATCTACAGCCTGAGGAACCGGGACATGAAGGCTGCTCTGAAG
AAACTCTTCCACTGCCACTCTTCCTCTTCTTCCCTCATG


Conceptual translation

MREENESSTIDFTLLGVTRQREQEYFFFILFLFIYPITVFGNMLIILAIHSDTRLHNPMY
FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMYFMISLGNTDSYILAAMAY
DRAVAISRPLHYATIMSPQLCVLLVAGSWVIANANALPHTLLTARLSFCGNKDVANFYCD
ITPLLQLSCSDIRFNVKMMYLGVGVFSVPLLCIIISYVRVFSTVLRVPSTKGFLKALSTC
GSHLTVVSLYYGTVMGMYFRPLTSYSLKHALITVMYTAVTPMLNPFIYSLRNRDMKAALK
KLFHCHSSSSSLM