Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1a1b Olfactory Receptor

Gene Symbol Or1a1b
Organism Mouse
Family 1
Subfamily a
Pseudo No
Location chr11:74,206,300-74,207,200 (-)
Aliases Olfr43

Sequence information


Nucleotide sequence

MREENESSTTDFTLLGVTRQREQEYFFFILFLFIYPITVFGNMLIILAIHSDTRLHNPMY
FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMYFMIGLANTDSYILAAMAY
DRAVAISRPLHYATIMSPQLCVLLVAGSWVIANANALPHTLLTARLSFCGNKDVANFYCD
ITPLLQLSCSDIRFNVKMMYLGVGVFSVPLLCIIISYVRVFSTVLRVPSTKGFLKALSTC
GSHLTVVSLYYGTVMGMYFRPLTSYSLKHALITVMYTAVTPMLNPFIYSLRNRDMKAALK
KLFHCPSSSSSLM


Conceptual translation

MREENESSTTDFTLLGVTRQREQEYFFFILFLFIYPITVFGNMLIILAIHSDTRLHNPMY
FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMYFMIGLANTDSYILAAMAY
DRAVAISRPLHYATIMSPQLCVLLVAGSWVIANANALPHTLLTARLSFCGNKDVANFYCD
ITPLLQLSCSDIRFNVKMMYLGVGVFSVPLLCIIISYVRVFSTVLRVPSTKGFLKALSTC
GSHLTVVSLYYGTVMGMYFRPLTSYSLKHALITVMYTAVTPMLNPFIYSLRNRDMKAALK
KLFHCPSSSSSLM