Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1a1b Olfactory Receptor

Gene Symbol Or1a1b
Organism Mouse
Family 1
Subfamily a
Pseudo No
Location chr11:74206276-74207214 (-)
Aliases Olfr43, RP23-20M18.3, IA7, MGC129217, MGC129218, MOR1, RP23-20M18.3, IA7, MGC129217, MGC129218, MOR1

Sequence information


Nucleotide sequence

ATGAGAGAAGAAAACGAGTCTTCTACCACAGATTTCACTCTCCTGGGAGTTACAAGGCAG
CGGGAGCAGGAATATTTCTTCTTCATCCTCTTCCTGTTCATTTACCCCATCACAGTGTTT
GGGAACATGCTCATCATCCTAGCCATTCACTCTGACACTCGCCTCCATAACCCTATGTAC
TTTTTCCTGGCCAACCTCTCCCTTGTTGACATCTTCTTCTCCTCTGTAACTATTCCCAAG
ATGCTGGCCAACCATCTCCTAGGTAGCAAGGCCATCTCCTTTGGGGGATGTATGGCACAG
ATGTACTTCATGATAGGCTTGGCAAATACAGACAGTTATATACTAGCTGCAATGGCATAT
GACCGAGCTGTGGCTATCAGTCGCCCACTTCATTATGCAACAATTATGAGTCCACAACTT
TGTGTCCTGCTGGTTGCTGGGTCCTGGGTGATTGCAAATGCTAATGCACTGCCCCACACC
CTACTCACAGCTAGACTGTCCTTCTGTGGCAATAAGGATGTGGCCAACTTCTACTGTGAC
ATTACACCTTTGCTCCAGCTGTCCTGTTCTGACATCCGCTTCAATGTGAAGATGATGTAC
CTTGGGGTGGGGGTCTTCTCTGTGCCACTGCTGTGCATCATCATCTCCTACGTCCGGGTC
TTTTCCACAGTCTTGCGGGTTCCATCTACCAAGGGCTTCCTGAAGGCCTTGTCCACCTGT
GGCTCTCACCTGACAGTGGTGTCCTTGTATTATGGGACAGTCATGGGCATGTATTTCCGG
CCCCTGACCAGTTACAGTCTGAAGCATGCATTGATAACTGTGATGTACACGGCAGTGACC
CCAATGCTGAACCCTTTCATCTACAGCCTGAGGAACCGGGACATGAAGGCTGCTCTGAAG
AAACTCTTCCACTGCCCCTCTTCCTCTTCCTCCCTCATG


Conceptual translation

MREENESSTTDFTLLGVTRQREQEYFFFILFLFIYPITVFGNMLIILAIHSDTRLHNPMY
FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMYFMIGLANTDSYILAAMAY
DRAVAISRPLHYATIMSPQLCVLLVAGSWVIANANALPHTLLTARLSFCGNKDVANFYCD
ITPLLQLSCSDIRFNVKMMYLGVGVFSVPLLCIIISYVRVFSTVLRVPSTKGFLKALSTC
GSHLTVVSLYYGTVMGMYFRPLTSYSLKHALITVMYTAVTPMLNPFIYSLRNRDMKAALK
KLFHCPSSSSSLM