Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1d2 Olfactory Receptor

Gene Symbol Or1d2
Organism Mouse
Family 1
Subfamily d
Pseudo No
Location chr11:74364671-74365606 (+)
Aliases Olfr412, MOR127-5P, MOR127-5P

Sequence information


Nucleotide sequence

ATGGACGGAGGCAACCAGAGTGGGGACTCTGAGTTCCTCCTCCTGGGACTCTCGGAGGTT
CCTGAGCATCAGCGCATCCTATTCTGGACCTTCCTGTCCATGTACCTGGTCACAGTGGTG
GGGAACGTGCTCATCATCCTGGCCATTGGCTCTGACTCGCACCTGCACACTCCCATGTAT
TTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACTATCCCCAAG
ATGCTGGTGAGCCTTCAATCCCAGAACAAAGCTATCTCCTATCCAGGATGTCTGACACAG
CTCTTCTTCCTGGTGTCTTTGGTAGCCTTGGACAATCTCATCCTGGCTGTAATGGCATAT
GACCGTTATGTGGCCATCTGTCACCCCCTCCATTACACTACAGCCATGAGTCCCAAGCTC
TGTATCTTACTTCTCATCTTGTGCTGGGCCCTATCTATCCTTTATGGCCTCATCCACACC
CTCCTCATGACCAGAGTAACCTTCTGTGGGTCTCGGAAAATCCACTACATCTTCTGCGAA
ATGTATGTCCTGCTGAGGCTTGCATGCTCTAACACCCACATCAATCACATGATGCTGATC
GCCACGGGCTGCTTCGTCTTCCTTGTTCCTTTTGGATTCATGATCATGTCCTATATCTGC
ATTGTCAGAGCTATCCTCAAAATTCCTTCAGCCTCTAACAAGTACAAAGCCTTTTCCACC
TGTGCGTCCCATCTGGCTGTGGTGGCCCTCTTCTATGGGACACTGTGTATGGTGTATCTG
AAACCCCTGCACACCTACTCCATGAAAGACTCAGTAGCCACTGTGATGTATGCAGTGGTG
ACACCCATGATGAACCCTTTCATCTACAGCCTGAGGAACAAGGACATGCACGGGGCTCTG
GGAAGACTGCTAAGGAAGCCACTTCAGAAGCTAACA


Conceptual translation

MDGGNQSGDSEFLLLGLSEVPEHQRILFWTFLSMYLVTVVGNVLIILAIGSDSHLHTPMY
FFLANLSFTDLFFVTNTIPKMLVSLQSQNKAISYPGCLTQLFFLVSLVALDNLILAVMAY
DRYVAICHPLHYTTAMSPKLCILLLILCWALSILYGLIHTLLMTRVTFCGSRKIHYIFCE
MYVLLRLACSNTHINHMMLIATGCFVFLVPFGFMIMSYICIVRAILKIPSASNKYKAFST
CASHLAVVALFYGTLCMVYLKPLHTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL
GRLLRKPLQKLT