Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1f19 Olfactory Receptor

Gene Symbol Or1f19
Organism Mouse
Family 1
Subfamily f
Pseudo No
Location chr16:3592398-3593336 (+)
Aliases Olfr161, MOR131-1, OR912-47M6, MOR131-1, OR912-47M6

Sequence information


Nucleotide sequence

ATGGGAGGCACCAACCAGTCCAGTGTCTCTGAGTTCCTCCTTCTGGGACTCTCCAGGCAG
CCCCAGCAGCAACAGCAGCTCATCTTTCTACTCTTCCTCATCATGTACCTGGCCACTGTC
TTGGGAAACCTGCTCATCATCCTGGCCATCAGCACAGACTCCCGCCTGCACACCCCCATG
TACTTCTTCCTCAGCAACCTGTCCTTTGTGGATGTATGCTTCTCCTCCACCACTGTCCCT
AAGGTACTGGCCATTCACATACTAAGAAATCAAGCCATTTCGTTCTCTGGGTGCCTCACA
CAGCTGTATTTTCTCTGTGTGTTTGCTGACATGGACAATTTCCTGCTGGCTGTGATGGCC
TATGACCGATTTGTGGCCATATGCCACCCTTTACACTACACAACAAAGATGACCCATCAG
CTTTGTGCCTTTCTTGTTGTTGGGTCCTGGATGGTAGCCAGTCTGAATGCTCTGTTGCAC
ACACTGCTCGTGGCTCAACTCTACTTCTGTGGGGACAATGTGATCCCCCACTTCTTCTGT
GAAGTGACTCCCCTGCTGAAACTCTCTTGCTCAGACACACATCTCAATGAGTTGATGATT
CTTGCTGTTGCAGGGCTGATAATGTTAGCTCCATTTGTTTGCATCCTCTTGTCTTATATC
CTTATTGCTTGTGCCATCCTGAAAATCTCATCCACAGGAAGATGGAAAGCCTTCTCTACC
TGTGGCTCACACTTGGCTGTTGTGTGCCTCTTCTATGGCACTATCATATCCCTGTATTTC
AACCCCTCATCTTCTCACTCAGCTGGGAGGGACATGGCAGCTGCCATGATGTACACAGTG
GTGACCCCCATGATGAAACCTTTCATCTACAGCCTGAGGAACAGGGACATGAAAGGGGCT
TTAAGGAAAGTGCTTACCATGAGATTTATATCTACACAG


Conceptual translation

MGGTNQSSVSEFLLLGLSRQPQQQQQLIFLLFLIMYLATVLGNLLIILAISTDSRLHTPM
YFFLSNLSFVDVCFSSTTVPKVLAIHILRNQAISFSGCLTQLYFLCVFADMDNFLLAVMA
YDRFVAICHPLHYTTKMTHQLCAFLVVGSWMVASLNALLHTLLVAQLYFCGDNVIPHFFC
EVTPLLKLSCSDTHLNELMILAVAGLIMLAPFVCILLSYILIACAILKISSTGRWKAFST
CGSHLAVVCLFYGTIISLYFNPSSSHSAGRDMAAAMMYTVVTPMMKPFIYSLRNRDMKGA
LRKVLTMRFISTQ