Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j1 Olfactory Receptor

Gene Symbol Or1j1
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36,812,200-36,813,100 (-)
Aliases Olfr3

Sequence information


Nucleotide sequence

MRLKNHSSVSEFLLLGFPIRPEQGGIFFSLFLAMYLITVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVTVPKMLTKVQNQPIPITYEECVSQTYFFIFFADLDSFLITSMAY
DRYMAICHPLHYITIMSQSRCAMLVAVSWVIASACALLHSLLLDQLSFCADHTVPHFFCD
LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPTTKGICKALST
CGSHLSVVALYYGSIIGLYFLPPSNSKINNNIVASVMYTVVTPMLNPFIYSLRNKDMKGA
LKKLLSKKTEFSK


Conceptual translation

MRLKNHSSVSEFLLLGFPIRPEQGGIFFSLFLAMYLITVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVTVPKMLTKVQNQPIPITYEECVSQTYFFIFFADLDSFLITSMAY
DRYMAICHPLHYITIMSQSRCAMLVAVSWVIASACALLHSLLLDQLSFCADHTVPHFFCD
LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPTTKGICKALST
CGSHLSVVALYYGSIIGLYFLPPSNSKINNNIVASVMYTVVTPMLNPFIYSLRNKDMKGA
LKKLLSKKTEFSK