Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j4 Olfactory Receptor

Gene Symbol Or1j4
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36850048-36850983 (+)
Aliases Olfr350, RP23-177C20.8, MOR136-13, RP23-177C20.8, MOR136-13

Sequence information


Nucleotide sequence

ATGAAAAGGGATAACCAGAGTATGGTGTCTGAATTCATCCTCCTGGGGCTCCCCATCCGG
CCAGAGGAGCAAGGCATGTACTATGCCCTGTTCTTGACCATGTACCTGACAACTGTGCTG
GGGAACCTGCTCATCATCCTACTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTAC
TTCTTCCTCAGCCACTTGGCCTTCACAGACATCTCTTTCTCATCTGTCACTGTACCCAAG
ATGCTGAGGAATATGCATATTCATGATCCATCCATTCCTTATGCAGAGTGTATAGCACAG
ATGTATTTTTTCATATTATTCACTGATCTGGACAACTTTCTCCTCACTTCAATGGCATAT
GATCGGTATGTGGCCATCTGTCATCCCCTGCACTACACCACCATCATGAGAGAGGAGCTC
TGTATCTTACTCGTAGCTATATCCTGGATCCTATCCTGTGTCAGTGCCCTGTCTCACACC
CTCCTCCTGGCCCGGCTATCCTTCTGTGCTGACAACACCATTTCTCATTTCTTCTGTGAC
CTTGCTGCCTTGCTGAAGCTCTCATGCTCAGACATCTCCCTCAATGAACTGGTCATTTTT
ACAGTAGGTACAACAGTCATTACTCTGCCATTAATATGTATCTTGATCTCTTATGGTCAC
ATTGTGGCCACCATTCTGAAAGTTTCATCTAACAAAGGGATCTGCAAAGCATTGTCCACA
TGTGGCTCCCACCTCTCTGTGGTGTCTCTGTATTATGGTACAATTATTGGAGTTTATTTT
ATACCTTCATCCTTTACTTCTACTGACAAGGGCATAGTTGCTTCTGTGATGTACACAGTG
GTCACTCCATTGCTGAACCCCTTCATTTATAGCATACGGAACAGAGACATGAAGGAGGCT
TTGAAAAAGCTCTTCAACAGAGCATCAATCTCAACT


Conceptual translation

MKRDNQSMVSEFILLGLPIRPEEQGMYYALFLTMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVTVPKMLRNMHIHDPSIPYAECIAQMYFFILFTDLDNFLLTSMAY
DRYVAICHPLHYTTIMREELCILLVAISWILSCVSALSHTLLLARLSFCADNTISHFFCD
LAALLKLSCSDISLNELVIFTVGTTVITLPLICILISYGHIVATILKVSSNKGICKALST
CGSHLSVVSLYYGTIIGVYFIPSSFTSTDKGIVASVMYTVVTPLLNPFIYSIRNRDMKEA
LKKLFNRASIST