Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1l8 Olfactory Receptor

Gene Symbol Or1l8
Organism Mouse
Family 1
Subfamily l
Pseudo No
Location chr2:36927183-36928112 (-)
Aliases Olfr355, MOR138-2, MOR138-2

Sequence information


Nucleotide sequence

ATGGAAGGAGTTAACCAAACTAGGTTTGTTTCTGAGTTCATACTCCTGGGACTGTCCCCT
CGGCCTGAGGACCAAAAACCACTGTTTATCCTCTTCCTCACAATTTACCTGGTTACTCTA
ACAGGGAACCTGCTCATCATTCTGGCCATCCGTTCTGACCCTCATCTCCATACTCCCATG
TATTTTTTCTTGAGTTTTCTGTCTTTAACTGACATTTGTTTCACTACAACTATTGTCCCC
AAGATGCTAGTGAATTTTCTGTCAGAAAAGAAGACCATCTCCTATGCAGGGTGTCTGACA
CAAATGTATTTTCTCTATGCTTTGGGTAACAGTGATAGCTGTCTTCTGGCAGTAATGGCC
TTTGACCGGTATGTAGCCATCTGCAACCCCTTCCACTATGTCACTATCATGAACCATCAT
CGATGTGCCCTACTGGTGACCTTCTCTTGCTCCTTTCCCCACTTCCATTCACTTTTGCAC
ACACTTTTACTTAATCTTCTGACCTTTTGTGACTCAAATGTTATTCACCATTTCCTCTGT
GACCTCAGTCCTCTGTTAAAATTATCCTGCTCCTCCACATTTGTCAATGAGATTGTGATA
GTGACAGAAGGAGCTCTTGTTTTGGTGACTCCCTTCCTATGCATTGCTTTCTCCTACATC
AGAATCCTTGTTACAGTTCTCAAGATCCCTTCTGCTGCTGGGAAACGCAAAGCCTTTTCC
ACTTGTGGTTCTCACTTCACTGTGGTAACCCTCTTTTATGGAAGCATCTTCTATGTGTAT
TTACAGCCTGTGTCTACTTATACTGTCAAAGACCATATAGCAACAATTGTCTACACAGTT
TTGTCATCTATGCTCAACCCTTTCATCTACAGCTTGAGAAACAAAGACCTGAAGCAGGGT
CTGAGGAAGCTCATAAGCAGAAGACACATC


Conceptual translation

MEGVNQTRFVSEFILLGLSPRPEDQKPLFILFLTIYLVTLTGNLLIILAIRSDPHLHTPM
YFFLSFLSLTDICFTTTIVPKMLVNFLSEKKTISYAGCLTQMYFLYALGNSDSCLLAVMA
FDRYVAICNPFHYVTIMNHHRCALLVTFSCSFPHFHSLLHTLLLNLLTFCDSNVIHHFLC
DLSPLLKLSCSSTFVNEIVIVTEGALVLVTPFLCIAFSYIRILVTVLKIPSAAGKRKAFS
TCGSHFTVVTLFYGSIFYVYLQPVSTYTVKDHIATIVYTVLSSMLNPFIYSLRNKDLKQG
LRKLISRRHI