Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1n1 Olfactory Receptor

Gene Symbol Or1n1
Organism Mouse
Family 1
Subfamily n
Pseudo No
Location chr2:36859417-36860346 (-)
Aliases Olfr351, RP23-177C20.9, MOR127-2, RP23-177C20.9, MOR127-2

Sequence information


Nucleotide sequence

ATGGAGAATGAGTCCAGTGTCTCTGAATTTTTTCTACAAGGAATATCAGGGTTCTCAGAG
CAACAGCAGCTACTCTATGGACTTTTTCTGTGTATGTATCTTGTCACCTTGACTGGGAAT
GTGCTCATTATCCTGGCCATTGGCTCTGACCCACACCTTCACACTCCTATGTACTTCTTT
TTGGCCAACTTGTCCTTTGCTGACATGGGTTTAATATCATCTACAGTGACCAAGATGTTG
TTTAATGTTCAGACAAGGTGCCATACCATTTCCTATACTGGTTGTCTCACACAGATGTAT
TTCTTTCTGATGTTTGGTGATCTGGACAGCTTCCTCCTGGCTGTGATGGCCTATGACCGC
TATGTGGCCATCTGTCACCCTCTCCACTATTCCACAATAATGAGTGCCCGAGTCTGTGCC
CTGATGCTTGCCTTGTGTTGGGTTCTCACCAACATAGTTGCCCTGACTCACACTCTCCTC
ATGGCTCGACTGTCCTTCTGTGTTGTTGGGGAAATAGCTCACTTTTTCTGTGACATTACT
CCTGTCCTGAAGCTCTCATGCTCTGACACTCATGTCAATGAACTTATGGTATTTGCCTTA
GGGGGTACAGTACTCATGGTCCCTTTTGTATGCATTGTTATCTCGTATATTCACATTGTA
TTTGCCATCCTAAAGGTTCGAACCCCTGGTGGCGGTACAAAGGCCTTTTCTACGTGTAGT
TCCCACCTCTGTGTGGTCTGTGTTTTCTATGGAACACTCTTCAGTGCCTACTTATGCCCT
CCCTCTGTAGTCTCTACAGAAAAGGATGTTGCAGCTGCTGCGATGTATACAGTGGTGACT
CCTATGTTGAACCCCTTCATCTACAGCCTTAGAAACAAGGATATGAAAGGGGCCCTAAAG
AGGCTTCTATGTCATAGGAAATTTTTATCT


Conceptual translation

MENESSVSEFFLQGISGFSEQQQLLYGLFLCMYLVTLTGNVLIILAIGSDPHLHTPMYFF
LANLSFADMGLISSTVTKMLFNVQTRCHTISYTGCLTQMYFFLMFGDLDSFLLAVMAYDR
YVAICHPLHYSTIMSARVCALMLALCWVLTNIVALTHTLLMARLSFCVVGEIAHFFCDIT
PVLKLSCSDTHVNELMVFALGGTVLMVPFVCIVISYIHIVFAILKVRTPGGGTKAFSTCS
SHLCVVCVFYGTLFSAYLCPPSVVSTEKDVAAAAMYTVVTPMLNPFIYSLRNKDMKGALK
RLLCHRKFLS