Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1s2 Olfactory Receptor

Gene Symbol Or1s2
Organism Mouse
Family 1
Subfamily s
Pseudo No
Location chr19:13,780,600-13,781,600 (+)
Aliases Olfr1496

Sequence information


Nucleotide sequence

MNMDQENQTSISEFILLGLSNQAEKQKLIFVIFLSMYLVTVIGNSLIILAIGLDIHLHTP
MYLFLANLSFADISSSSTSVPKMLMNIQTNSQSISYEGCITQMYFSIVFVVIDNFLLGVM
AYDRYVAICHPLNYTNIMHPRFCLLLSFCPWALSNIVALTHTLLANQLIFCNHNTIQHFF
CDLAPLIKLSCSDAMINELVKFVVGLSVITFPFALILFSYVCIIRDVLRISSTEGKWKAF
STCGSHLTIVFLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMLNPFIYSLRNKDMK
GALRKLINKSHLLPLMS


Conceptual translation

MNMDQENQTSISEFILLGLSNQAEKQKLIFVIFLSMYLVTVIGNSLIILAIGLDIHLHTP
MYLFLANLSFADISSSSTSVPKMLMNIQTNSQSISYEGCITQMYFSIVFVVIDNFLLGVM
AYDRYVAICHPLNYTNIMHPRFCLLLSFCPWALSNIVALTHTLLANQLIFCNHNTIQHFF
CDLAPLIKLSCSDAMINELVKFVVGLSVITFPFALILFSYVCIIRDVLRISSTEGKWKAF
STCGSHLTIVFLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMLNPFIYSLRNKDMK
GALRKLINKSHLLPLMS