Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2a7 Olfactory Receptor

Gene Symbol Or2a7
Organism Mouse
Family 2
Subfamily a
Pseudo No
Location chr6:43,174,000-43,174,900 (+)
Aliases Olfr13

Sequence information


Nucleotide sequence

MGNNMTLITEFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTIVGLICLDSRLHTPMYF
FLSHLAIVDIAYACNTVPQMLVNLLDPVKPISYAGCMTQTFLFLTFAITECLLLVVMSYD
RYVAICHPLRYSAIMSWRVCSTMAVTSWIIGVLLSLIHLVLLLPLPFCVSQKVNHFFCEI
TAILKLACADTHLNETMVLAGAVSVLVGPFSSIVVSYACILGAILKIQSEEGQRKAFSTC
SSHLCVVGLFYGTAIVMYVGPRHGSPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTL
KRVLRTQRAL


Conceptual translation

MGNNMTLITEFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTIVGLICLDSRLHTPMYF
FLSHLAIVDIAYACNTVPQMLVNLLDPVKPISYAGCMTQTFLFLTFAITECLLLVVMSYD
RYVAICHPLRYSAIMSWRVCSTMAVTSWIIGVLLSLIHLVLLLPLPFCVSQKVNHFFCEI
TAILKLACADTHLNETMVLAGAVSVLVGPFSSIVVSYACILGAILKIQSEEGQRKAFSTC
SSHLCVVGLFYGTAIVMYVGPRHGSPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTL
KRVLRTQRAL