Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2aj4 Olfactory Receptor

Gene Symbol Or2aj4
Organism Mouse
Family 2
Subfamily aj
Pseudo No
Location chr16:19565943-19566884 (-)
Aliases Olfr169, MOR273-3P, MOR273-3P

Sequence information


Nucleotide sequence

ATGATGGAATATGAGAACTACACTTTTAACAGCGACTTCATCCTCTTGGGACTGTTCTCT
TCTTCAAAGACAAGCTTAACTTTTTTCTCATTTATATTTTTCATTTTTATTATGGCTATA
ACAGAAAATGCCCTCATGATCCTCCTAATCCACAGGGATTCTCGACTCCATACCCCAATG
TATTTCCTGCTTAGTCATCTCTCCTTCATGGATATCTTGCACATTTCCAACATTGTTCCT
AAAATGATTGCTGACTTCCTCTCAGGCAGCAGAACTATTTCCTTTGCAGGCTGTGCCTTC
CAGATATTTCTCTCTCTTACCTTGCTAGGTGGTGAGTGCCTTCTCCTGGCAGCCATGTCC
TATGATCGATATGTGGCCATCTGCCACCCACTTCGCTACCCTGTGCTGATGAGGGATAAC
TCCAGTAGGCTCCTGGCTGCAGGCTCCTGGCTGGTGGGGATCCTCAACTCCATAGTACAC
ACAGTTTTTGCACTCCACTTTCCCTTCTGCCACTCAAGAGCCATTGATCACTTTTTCTGC
GAAGTCCCTGCCATGTTGAAATTGTCATGTATAGACACAACACACTATGAACGAGGCGTT
TATGTGAGTGGCATTATTTTTCTGCTGATCCCATTTTCCATGATCTCTATATCTTATGTG
CAAATTCTCCTCACTGTATTCCAAATGCAGTCATCAGGGGCCCGGCAAAAGTCCTTTTCC
ACCTGTTCCTTCCACATGGTTGTTGTCATAATGTACTATGGGCCATTCATTTTTACATAT
ATGAGACCTCGCTCATACCACACTCCAGGGCAGGATAAATTTTTGGCAATATTCTACACC
ATCCTGACACCCACACTCAACCCCATAATCTACAGCTTTCGTAATAAAGATGTCCTTATG
GCTGTGAAAAACATCGTCCAAAGTAATTTTTTGAATAAAAAA


Conceptual translation

MMEYENYTFNSDFILLGLFSSSKTSLTFFSFIFFIFIMAITENALMILLIHRDSRLHTPM
YFLLSHLSFMDILHISNIVPKMIADFLSGSRTISFAGCAFQIFLSLTLLGGECLLLAAMS
YDRYVAICHPLRYPVLMRDNSSRLLAAGSWLVGILNSIVHTVFALHFPFCHSRAIDHFFC
EVPAMLKLSCIDTTHYERGVYVSGIIFLLIPFSMISISYVQILLTVFQMQSSGARQKSFS
TCSFHMVVVIMYYGPFIFTYMRPRSYHTPGQDKFLAIFYTILTPTLNPIIYSFRNKDVLM
AVKNIVQSNFLNKK