Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2b2 Olfactory Receptor

Gene Symbol Or2b2
Organism Mouse
Family 2
Subfamily b
Pseudo No
Location chr13:21,703,000-21,703,900 (+)
Aliases Olfr1359

Sequence information


Nucleotide sequence

MSVANESISREFILLGFSDRPWLELPLFVVFLVSYILTIFGNMMIILVSRLDSKLHTPMY
FFLTNLSLLDLCYTTSTVPQMLINICSTRKVISYGGCVAQLFIFLALGSTECFLLGVMSF
DRFVAICRPLHYSVIMHQRRCLQLAAACWISGFSNSVLQSTWTLQMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIRSAEGRRKAFGT
CGSHLIVVVLFYGTAIYMYLQPPSPTSKDRGKMVSLFYGIITPMLNPLIYTLRNKEVKGA
FKRLVTRIILSRK


Conceptual translation

MSVANESISREFILLGFSDRPWLELPLFVVFLVSYILTIFGNMMIILVSRLDSKLHTPMY
FFLTNLSLLDLCYTTSTVPQMLINICSTRKVISYGGCVAQLFIFLALGSTECFLLGVMSF
DRFVAICRPLHYSVIMHQRRCLQLAAACWISGFSNSVLQSTWTLQMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIRSAEGRRKAFGT
CGSHLIVVVLFYGTAIYMYLQPPSPTSKDRGKMVSLFYGIITPMLNPLIYTLRNKEVKGA
FKRLVTRIILSRK