Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2b2b Olfactory Receptor

Gene Symbol Or2b2b
Organism Mouse
Family 2
Subfamily b
Pseudo No
Location chr13:21,674,000-21,674,900 (-)
Aliases Olfr1360

Sequence information


Nucleotide sequence

MSVANESISREFILLGFSDRPWLELPLFVVFLVSYILTIFGNMMIILVSRLDSKLHTPMY
FFLTNLSLLDLCYTTSTVPQMLINICSTRKVISYGGCVAQLFIFLALGCTECFLLGVMSF
DRFVAICRPLHYSVIMHQRRCLQLAAACWISGFSNSVLQSTWTLQMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIRSAEGRRKAFGT
CGSHLIVVVLFYGTAIYMYLQPPSPTSKDRGKMVSLFYGIITPMLNPLIYTLRNKEVKGA
FKRLVTRIILSRK


Conceptual translation

MSVANESISREFILLGFSDRPWLELPLFVVFLVSYILTIFGNMMIILVSRLDSKLHTPMY
FFLTNLSLLDLCYTTSTVPQMLINICSTRKVISYGGCVAQLFIFLALGCTECFLLGVMSF
DRFVAICRPLHYSVIMHQRRCLQLAAACWISGFSNSVLQSTWTLQMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIRSAEGRRKAFGT
CGSHLIVVVLFYGTAIYMYLQPPSPTSKDRGKMVSLFYGIITPMLNPLIYTLRNKEVKGA
FKRLVTRIILSRK