Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2f1 Olfactory Receptor

Gene Symbol Or2f1
Organism Mouse
Family 2
Subfamily f
Pseudo No
Location chr6:42,744,000-42,745,000 (+)
Aliases Olfr453

Sequence information


Nucleotide sequence

MGKDNQTWIHEFILLGLSSDWNTEVSLFVLFLLMYLVTVLGNFLIIVLIRLDSRLHTPMY
FFLTNLSLVDVSYATSIVPQLLAHFLATHKTIPFLSCAAQLFFSLGLGGIEFVLLAMMAY
DRYVAVCNPLRYSAIMHTGLCSRMAIVSWVGGSINSVMQTAITFQLPMCTNVYIDHISCE
LLAVVRLACVDTSANEVAIMVSSIILLMTPFCLVLLSYIQIISTILKIQSKEGRKKAFHT
CASHLTVVALCYGMAIFTYIQPHSSPSVLQEKLISLFYAILTPMLNPMIYSLRNKEVKGA
WQKLLGQFSEFTSKLKT


Conceptual translation

MGKDNQTWIHEFILLGLSSDWNTEVSLFVLFLLMYLVTVLGNFLIIVLIRLDSRLHTPMY
FFLTNLSLVDVSYATSIVPQLLAHFLATHKTIPFLSCAAQLFFSLGLGGIEFVLLAMMAY
DRYVAVCNPLRYSAIMHTGLCSRMAIVSWVGGSINSVMQTAITFQLPMCTNVYIDHISCE
LLAVVRLACVDTSANEVAIMVSSIILLMTPFCLVLLSYIQIISTILKIQSKEGRKKAFHT
CASHLTVVALCYGMAIFTYIQPHSSPSVLQEKLISLFYAILTPMLNPMIYSLRNKEVKGA
WQKLLGQFSEFTSKLKT