Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2f2 Olfactory Receptor

Gene Symbol Or2f2
Organism Mouse
Family 2
Subfamily f
Pseudo No
Location chr6:42790041-42790991 (+)
Aliases Olfr452, MOR257-5P, MOR257-5P

Sequence information


Nucleotide sequence

ATGGAACAAGACAACCAGACATGGGTGCATGAATTCATCCTTCTTGGCCTTTCCAATGAC
TGGGGCACTCAAGTCTCCCTCTTCGTCCTGTTCTTGCTGATGTACCTGGTGACAGTATTG
GGGAACTTCCTCATCATTGTTCTGATCAGACTGGACAGCAGACTCCACACTCCCATGTAT
TTCTTTCTCACCAACCTGTCCCTGGTGGATGCATCTTATGCCACAAGCATAGTCCCCCAG
CTGCTGGCTCATTTCCTTGCCACACACAAAGCAATTCCATTTCTGAGCTGTGCAGCCCAG
TTATTTTTTTCCCTGGGCTTGGGTGGGATCGAGTTCCTTCTGCTGGCAGTGATGGCCTAT
GACCGCTATGTGGCAGTGTGTGATCCTCTGAGGTATTCAGTCATCATGCATACAGGGCTC
TGCACAAGGCTGGTCATCACATCGTGGGTCAGTGGCTCCATCAATTCTCTTGTGCACACT
GCCATCACCTTCCAGCTGCCCATGTGCACAAATAAGTATATTGATCACATTTCCTGTGAA
ATTCTAGCTGTGGTCCGATTGGCCTGTGTGGACATTTCATCCAATGAGATTGTGATCATG
GTTTCTAGCATTGTCTTGCTTATGACACCTTTCTTTCTGGTTCTTTTGTCCTACATTCAA
ATCATCTCCACCATTCTGAAAATCCAGTCTACAGAGGGAAGGAGGAAGGCCTTCCACACC
TGTGCCTCCCACCTCACTGTGGTAACATTATGCTATGGTACCACCATTTTTACCTACATC
CAGCCCCACTCCAGCCCCTCAGTCCTTCAAGAGAAGTTGATTTCCCTTTTTTATGCTGTA
TTGATGCCCATGCTGAATCCTATGATTTATAGTCTAAGGAATAAGGAGGTGAAAGGGGCT
TGGCAGAAACTATTAGGAAAATTCTCTGTGTTCACATCAAAACTGACAAGT


Conceptual translation

MEQDNQTWVHEFILLGLSNDWGTQVSLFVLFLLMYLVTVLGNFLIIVLIRLDSRLHTPMY
FFLTNLSLVDASYATSIVPQLLAHFLATHKAIPFLSCAAQLFFSLGLGGIEFLLLAVMAY
DRYVAVCDPLRYSVIMHTGLCTRLVITSWVSGSINSLVHTAITFQLPMCTNKYIDHISCE
ILAVVRLACVDISSNEIVIMVSSIVLLMTPFFLVLLSYIQIISTILKIQSTEGRRKAFHT
CASHLTVVTLCYGTTIFTYIQPHSSPSVLQEKLISLFYAVLMPMLNPMIYSLRNKEVKGA
WQKLLGKFSVFTSKLTS