Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2h2 Olfactory Receptor

Gene Symbol Or2h2
Organism Mouse
Family 2
Subfamily h
Pseudo No
Location chr17:37085234-37086163 (-)
Aliases Olfr90, MOR256-21, bM573K1.2, MOR256-21, bM573K1.2

Sequence information


Nucleotide sequence

ATGGTCAACCAGAGCTCCCCCGTGGGCTTCCTCCTGCTGGGCTTCTCTGAACACCCACAA
CTGGAAAAGGTTCTCTTCGTCGTTGTCTTGTGCTCCTACCTCCTCACCCTCCTAGGAAAC
ACACTAATCCTCCTGCTGTCCACCCTGGATCCCAGGCTCCACTCTCCAATGTACTTCTTC
CTCTCTAACCTCTCCTTCTTGGACCTCTGCTTCACCACAACCTGTGTCCCCCAGATGCTG
TTCAACCTCTGGGGCCCCGAAAAGACCATCAGCTTCCTGGGATGCTTTGTCCAGCTCTTC
ATCTTCTTATCTCTGGGGACGACGGAGTGCATCCTGCTAGCAGTGATGGCCTTTGACCGC
TATGTGGCTGTGTGCCAGCCCCTGCACTATGCCACCATCATCCACCCTCGCCTGTGTTGC
CAGCTGGCAGCTGTGGCCTGGACGATTGGCCTAGTGGAGTCAGTAGTTCAGACGCCATCC
ACTCTGCGCCTGCCCTTCTGTCCCCACCATCAGGTTGACGACTTTGTGTGTGAGGTCCCT
GCTTTGATTCGACTGTCCTGTGGGGACACCACCTATAATGAGATACAAATGGCTATTGCC
AGTGTCTTCATCTTGGTTGTACCTCTGAGCCTCATCCTTGTCTCTTATGGTGCCATTGCC
AGGGCAGTGCTGAGGATAAGCTCTGCAAAGGGGCGCAGGAAAGCTTTTGGGACCTGCTCT
TCCCACCTCATTGTGGTCACTCTCTTCTACAGCTCAGTCATCGCTGTTTATCTGCAGCCC
AAGAATCCTTATGCTCGAGAGAGGGGCAAGTTCTTTGGTCTCTTCTATGCTGTGGGAACT
CCTTCTCTTAACCCTCTCATATATACCCTAAGGAACAAGGAAGTAAAGAGGGCATTCAGG
AGGCTGCTCTGGAAGGAAGTGAAGCCCGGC


Conceptual translation

MVNQSSPVGFLLLGFSEHPQLEKVLFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
LSNLSFLDLCFTTTCVPQMLFNLWGPEKTISFLGCFVQLFIFLSLGTTECILLAVMAFDR
YVAVCQPLHYATIIHPRLCCQLAAVAWTIGLVESVVQTPSTLRLPFCPHHQVDDFVCEVP
ALIRLSCGDTTYNEIQMAIASVFILVVPLSLILVSYGAIARAVLRISSAKGRRKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNPYARERGKFFGLFYAVGTPSLNPLIYTLRNKEVKRAFR
RLLWKEVKPG