Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2l5 Olfactory Receptor

Gene Symbol Or2l5
Organism Mouse
Family 2
Subfamily l
Pseudo No
Location chr16:19,514,700-19,515,600 (-)
Aliases Olfr167

Sequence information


Nucleotide sequence

MDSYNQTFTGFILLGLFPPSKIGLFLFILIVLIFLTAWIGNLSMILLILLDSHLHTPMYF
LLSQLSLIDLNYISTIVPKMVSDFMLGNKYISFIGCGFQIFLFLTFGGAETLLLASMAYD
RYVAICFPLHYATHMNKRVCVMMITGAWILGSINSCAHTGYALQIPYCRSRAINHFFCDV
PAMLTLACTDTWVYEYTVFVSTILFLVFPFIGIVCSYGRVFLAIYRMHSRAGKKKAYSTC
STHLTVVTFYYAPFAYTYLRPRSLRSPEEDKILAVFYTVLTPMLNPIIYSLRNKEVIGAL
RRMTHRICFAKI


Conceptual translation

MDSYNQTFTGFILLGLFPPSKIGLFLFILIVLIFLTAWIGNLSMILLILLDSHLHTPMYF
LLSQLSLIDLNYISTIVPKMVSDFMLGNKYISFIGCGFQIFLFLTFGGAETLLLASMAYD
RYVAICFPLHYATHMNKRVCVMMITGAWILGSINSCAHTGYALQIPYCRSRAINHFFCDV
PAMLTLACTDTWVYEYTVFVSTILFLVFPFIGIVCSYGRVFLAIYRMHSRAGKKKAYSTC
STHLTVVTFYYAPFAYTYLRPRSLRSPEEDKILAVFYTVLTPMLNPIIYSLRNKEVIGAL
RRMTHRICFAKI