Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2t1 Olfactory Receptor

Gene Symbol Or2t1
Organism Mouse
Family 2
Subfamily t
Pseudo No
Location chr14:14328113-14329063 (+)
Aliases Olfr31, MGC123774, MGC123790, MOR274-1, MTPCR53, MGC123774, MGC123790, MOR274-1, MTPCR53

Sequence information


Nucleotide sequence

ATGGAAGGGGACAACACATCATCCACGGACTTCACTTTCATGGGGCTGTTCAACACAGAG
GAAACCTCAGGTCTTGTATTTGCCACAATCTCCGTCATCTTCCTCACTGCACTGGTGGCC
AATGGAATTATGATCTTTCTGATCCACACAGACGCTCACCTCCACACCCCTATGTACTTT
CTCCTCAGTCACTTGTCCTTCATTGACATGATGTACATCTCAACCATTGTGCCCAAGATG
CTAGTTGATTATCTTCTAGGGCAAAGGACTATTTCCTTTGTGGGATGCACAGCTCAACAC
TTTCTATACCTCACCCTGGTGGGAGCCGAGTTCTTTCTTCTGGGCCTCATGGCTTATGAT
CGTTATGTGGCCATCTGCAACCCACTGAGGTACCCTGTCCTCATGAGCCGCCGGATCTGT
TGGATTATCATAGCAGGCTCCTGGTTTGGGGGATCTTTGGATGGCTTCCTCCTCACTCCA
ATCACCATGAGTTTTCCTTTCTGTAGATCACGAGAGATTAACCACTTCTTCTGTGAGGCA
CCTGCTGTGCTGAAGTTGGCATGTGCAGACACAGCCCTCTATGAGACGGTGATGTATGTG
TGCTGCGTTCTGATGCTGTTGATTCCTTTCTCTGTGGTTATCTCATCCTATGCGCGGATT
CTGGCCACTGTCTACCATATGAGCTCTGTGGAAGGAAGGAAGAAAGCGTTTGCTACCTGC
TCGTCTCACATGACTGTGGTAACCTTGTTTTATGGGGCTGCCATATACACCTATATGGTA
CCACACTCTTACCATTCCCCATCCCAAGACAAAATTTTTTCTGTGTTCTATACCATTCTC
ACACCCATGCTGAACCCCCTCATTTACAGCATGAGGAACAAAGATGTGTCTGGAGGTCTG
AGGAGGGCACTGGGGAAGATCGGGAGTTCTCAGCGAGTGTCCAAAGACTTT


Conceptual translation

MEGDNTSSTDFTFMGLFNTEETSGLVFATISVIFLTALVANGIMIFLIHTDAHLHTPMYF
LLSHLSFIDMMYISTIVPKMLVDYLLGQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYD
RYVAICNPLRYPVLMSRRICWIIIAGSWFGGSLDGFLLTPITMSFPFCRSREINHFFCEA
PAVLKLACADTALYETVMYVCCVLMLLIPFSVVISSYARILATVYHMSSVEGRKKAFATC
SSHMTVVTLFYGAAIYTYMVPHSYHSPSQDKIFSVFYTILTPMLNPLIYSMRNKDVSGGL
RRALGKIGSSQRVSKDF